SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428308804|ref|YP_007119781.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428308804|ref|YP_007119781.1|
Domain Number 1 Region: 1198-1276,1358-1604
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.17e-102
Family WD40-repeat 0.00000642
Further Details:      
 
Domain Number 2 Region: 1029-1315
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.41e-93
Family WD40-repeat 0.00000332
Further Details:      
 
Domain Number 3 Region: 533-743
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000135
Family G proteins 0.043
Further Details:      
 
Domain Number 4 Region: 302-490
Classification Level Classification E-value
Superfamily TPR-like 0.0000000701
Family Transcription factor MalT domain III 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428308804|ref|YP_007119781.1|
Sequence length 1637
Comment WD40 repeat-containing protein [Microcoleus sp. PCC 7113]
Sequence
MESHPDDVSAKNNESLRTLARAITLSQGFFSIVLARCNYQSLRQPLVQKLRERCAVGFKE
ITLKPSTRTLYTTIRAALDGEEPNAVIVSGLELVNDLEGLLIASNHARDEFRKHFSFPLV
LWVTDEVLQKFMRVAPDFTSWAATPIGFTIATPDLIKALEQNAESVFEAILKTGSGKFLN
NTDLNLEMGSRRRLELESALKDLQNRGDVLEPALEADLQFLIGLDADTHDRMEESRQYYE
RSLAFWLEQLESQESEALRLNAPSQSINPKLFERVGCLLYYLGLWWRKYATLRRSEYRFA
CSQAKNYFQQCIDVFKQGNRPELMGQFINSLGETLQKLEEWDELEAIAKLAVQLHQTYFD
PIRLSYGYGLLAELALSNKAWKIAREFSKLALQTNAKSTRLSCDLLTKNIDNVWSQRHDQ
NLYLLLLAQAQKHLGQLPQAIKLLEIAKTKSNPQIDPSLYIRILAELRSLYWNQGRYLDA
FRIKQKQSEIEYQYGFRAFIGASQLRPRCQVANPAIAPVDTLSTIAQEIAASGRQQDINR
LIERISRTDYKLTVIHGPSGVGKSSLVTAGLVPALEQKAIGDRDALPIVVRGYTNWVNDL
GQSLLRDLSVSLTDAISEVRDINLAIPEDIPKFIINQLRKNADRNLLTVLIFDQIEEFFF
IYSEPNTRCLLYNFLRDCLEIPYVKVILSLREDYLHYLLECERCTNLDVINNNILDKKIR
YYLGNFSPKDAKAVIHSLNERSQFYLESTLIDELVRDLAEDTGDVSPIELQVVGAQLHAE
AIVSLEDYQRLGFNPKQKLVERFLQEAIKDCGPPNARAALLVLYLLTEENGTRPPKTRAE
LAGELDDTELESKDEQLDLVLEILTKSGLLMLLPDAPADRYQLVHDYLVSFIRQKKDAEV
GLEAALQRERNQRKLTEQQLSRVSRQRKQVGVAVIVVTVFALMAGGLALLTESQRKRAEI
AEIRALSSLSSALLLSDNQLGALVESVKVGKRLKELEHELQTSLLTLKNRKISSDIRLQT
LGSLQQSVYRIQERNRLEQHNGIVNSVSFSPDGKMIASASADTTIKLWKLNQTLPKTLEG
HNGIVNSVSFSPNGKLIASASDDKTIKLWSIDGTLLRTFTGHQGWVKSVSFSPDSQQIAS
GSHDKTVKLWSVNGTLLRTFTGHGDWVNNVSFSPDGKQIASGSNDKTIKLWSVDGSGVKT
LTGHEDWVKSVSFSPDGQQIASASTDKTIKLWNTNGSFLRTLEGHTEWVNSVSFSPDGQQ
IASASTDKTIKLWNTQGTLLESLKGHSNSVQGIRFSPDGKILASASEDNTIKLWSLSRIP
LPTLNMHEQKVTSASFSPNGQMIASASADQTVKIWSVKGELLHTLTGHNGIVNSVSFSPD
GETIASASADQTVKLWSINGELLHTLTGHQNWVNSVSFSPDGETIASASADKTVRLWNKD
GQLQKTLTGHTDWVNSVSFSPDGKTIASASNDRTVKLWNLDGTELDTLRGHTNGVNDIRF
SPDGEILASASNDSTIKLWNKDGTLRTTLYGHLGRVTSVRFHPDGYTLASASADKTLKFW
SLDGNVLRTLEGNGSSINSVSFSWDGKTIASASDEKVVILWNFDLNDLLVRGCAWLHDYL
KNPNANIKPEENRYICD
Download sequence
Identical sequences K9W7L0
gi|428308804|ref|YP_007119781.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]