SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428308938|ref|YP_007119915.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428308938|ref|YP_007119915.1|
Domain Number 1 Region: 798-912,961-1035
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.71e-34
Family Histidine kinase 0.0041
Further Details:      
 
Domain Number 2 Region: 506-676
Classification Level Classification E-value
Superfamily GAF domain-like 9.38e-30
Family GAF domain 0.0015
Further Details:      
 
Domain Number 3 Region: 352-489
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.93e-29
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.065
Further Details:      
 
Domain Number 4 Region: 218-353
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.41e-22
Family Heme-binding PAS domain 0.08
Further Details:      
 
Domain Number 5 Region: 708-748,778-809
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000126
Family Homodimeric domain of signal transducing histidine kinase 0.01
Further Details:      
 
Weak hits

Sequence:  gi|428308938|ref|YP_007119915.1|
Domain Number - Region: 11-65
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000489
Family N-terminal PAS domain of Pas kinase 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428308938|ref|YP_007119915.1|
Sequence length 1044
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MQLEGQPSVFANLELFSAFVEHMPAAVAMLDCELRYLLTSRRWLSDYALENQDLVGREYY
KIFPLFLHEQGRVSPPHSSPCGLSFENTSSNDSNSLTPLPSWTKTPVISSTSFHWLERWR
KIFALSLAGETQRGDSAYFIKPDGSRQRVKWEIQPWRTRNGEIGGIMISTEFQESPSIAE
VPDCESEPSYCRFRETATQGIWGTGSLSNTIEQLQQEIAERQQAQALQQESEERYRSLIA
AMAEGIILQDANGIIRTCNAAAERILGVSADQLLGRTLMESHWLIITEEGEAISQEEHPL
HLTLRTGQSFTDVIIGLYKPDSSLTWLSLNSQPLFRPQETTPYSAVVSLIDITKRKQIGA
ALRESEERFRATFEQAAVGITHAELDGSFVRVNQKFCDIVGYTREDILQRTLQDITHPED
REVDRKYLRSLLIGEIETYSLEKRYLRQDGEAIWVEITASLVHTPQGNSAAGRITLLPQY
FLCVVQDISDRKAAEAALRNSEAKLRQRAQREELLNRLSNQIRRSLDLNTILETAVREIR
HLLQIDRCQFAWYYADERRSYWEVVKEARNLDCAERTGRYPADLIGPLNQRLLNLEILRI
DDVETIGDPIFQSFIRSFSCTSVLSLPMQTPSGTIGVINCIHTQEARPWTDWELELLQAV
KAQLLIAIKQAELYAASRRSTQEAQEKATQLQQTLHELQRTQAQLIQSEKMSSLGQLVAG
VAHEINNPVNFIYGNLIHAQGYFQELLGLLSLYRATYPHPPGMIQDYIEAIDLDFLMTDL
TQLQDSMKIGAERIREIVRSLRTFSRLDESESKQVDIHSGIESTLMILQNRLKGKPGCPA
ISVIKQYGNLPLVECYPGQLNQVFMNLLTNAIDAVDEKSRCQSSQAHGTQEESIIHPPPT
ITITTGIVLTDKQEDHSLSEEERSKEEGDMEYCQANCFASPLLSCKNLNSSVHSPTISPT
HVFICIADNGIGMTQKTQQQLFDPFFTTKAVGKGTGLGLAISYQIIVEKHGGDLRCNSAL
GDGAEFVIEIPIKHHQRQSQLSHK
Download sequence
Identical sequences K9W9Q9
WP_015180673.1.75295 gi|428308938|ref|YP_007119915.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]