SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428308970|ref|YP_007119947.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428308970|ref|YP_007119947.1|
Domain Number 1 Region: 14-72
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000152
Family Phage repressors 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428308970|ref|YP_007119947.1|
Sequence length 79
Comment transcriptional regulator [Microcoleus sp. PCC 7113]
Sequence
MPQESDKRLTPADLRQRTGLTQVHFAISIGKSPSTITKWEARSSLPRGTPSEIKRMCEAY
KCTLDELIEAFEGIDIEPE
Download sequence
Identical sequences K9W9P4
gi|428308970|ref|YP_007119947.1| WP_015180704.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]