SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428309011|ref|YP_007119988.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309011|ref|YP_007119988.1|
Domain Number 1 Region: 22-170
Classification Level Classification E-value
Superfamily CheY-like 1.17e-30
Family CheY-related 0.0018
Further Details:      
 
Domain Number 2 Region: 159-325
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000000000198
Family GAF domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428309011|ref|YP_007119988.1|
Sequence length 330
Comment response regulator with CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Microcoleus sp. PCC 7113]
Sequence
MDDVIPNFDQIKRQLMSLERPKKPKMLVVDDEPDNLDLLYRTFRRDFEVLRADSGVNALS
LLSTSGEVAVIISDQRMPEMKGTEFLSKTVPQFPDTVRIILTGFTDVEDLVEAINSGQVY
KYITKPWDPHELRSVVQRAAESYELLKQRTEELHRSQAQMALLMTIVQAAQESDSLNSCL
EPIAQAFGENFSADACILQLVENNQLTSVKGIYTQSEILESPLEKDPLAQAVIGNTTDTP
HETQELQLWVNTPSSTLTAEAEYYRNVGLYMHLLVPIIYRGERLAVLSLQWKQKTTHLQE
DEIKLIHLAAQQVGLALTSTRAYRPRAQEA
Download sequence
Identical sequences K9WAS4
WP_015180745.1.75295 gi|428309011|ref|YP_007119988.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]