SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428309070|ref|YP_007120047.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309070|ref|YP_007120047.1|
Domain Number 1 Region: 5-155
Classification Level Classification E-value
Superfamily CheY-like 5.12e-42
Family CheY-related 0.00031
Further Details:      
 
Domain Number 2 Region: 922-1103
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.06e-39
Family Histidine kinase 0.0061
Further Details:      
 
Domain Number 3 Region: 1131-1257
Classification Level Classification E-value
Superfamily CheY-like 3.13e-38
Family CheY-related 0.0068
Further Details:      
 
Domain Number 4 Region: 669-839
Classification Level Classification E-value
Superfamily GAF domain-like 1.68e-28
Family GAF domain 0.0061
Further Details:      
 
Domain Number 5 Region: 852-934
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 4.12e-22
Family Homodimeric domain of signal transducing histidine kinase 0.0011
Further Details:      
 
Domain Number 6 Region: 278-391
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.18e-22
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.02
Further Details:      
 
Domain Number 7 Region: 386-520
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.44e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.014
Further Details:      
 
Domain Number 8 Region: 519-651
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.5e-16
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.041
Further Details:      
 
Domain Number 9 Region: 173-268
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000279
Family Heme-binding PAS domain 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428309070|ref|YP_007120047.1|
Sequence length 1340
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MLTANPSTILIVDDQPTNLKMLFSFLQESGFKVLVAQSGESAITKLKKVAPDLILLDVML
PGLDGFETCRRLKATAETQDIPVIFMTALSESLDKIKGLKVGAVDYITKPFQQEEVLARI
ENQLKIRRLSVQLELQNQKLQQSQSLLTGILNTSQDGVMVFEAMRDSRGEIVDFKWILAN
PVTEKMTGRTPQDLLGKQLLVELPGNCEAGLFERYVSVVETGIPQEQEFYYDYDGIKAWF
VHVAVKLGDGFAVTFRDITEQKQAADALLIAQKRLEYLLSSSPAIIYSCKPDDYSSTFVS
ENVNLVLGYEAQEFLEDASFWVTHIHPDDREGVFAELPQLFERGQHSAEYRFLHKDGTYR
WLLDVIKLVRDEEGNPLECIGSLSDITQRKQVEAKLQESQHWLSAITDANPNIVYVYDLI
EQRNFFINREVYTILGYTPEQVQQMGTALLQTLMHPEDFVEIPEHFQRFESAKDGEILEF
EYRMRYKHGDWRWLLARETVFARNTDGKPTQILGTAADISDRKAIEIALQQSEARIQNLA
ANVPGMLYEFLRYPDGSYRFTYVSSGCRHINELEPKQILENPALGFELTHPDDVASLFES
IETSAQTLEPWVWEGRIITPSGRLKWIRGAAQPERCGDGEILWHGLVIDVSDRKATELEL
QAAKTTLERHIQRVLLQERITQEIRSSLNSKQVFQTAAIQIGEAFGVNRCLIHTYIEYPT
PLIPLVAEYKPPGLVSLLNLEIPVIGNPHVQAMLAQDQAIASDNIYTEPLLKGALPLCQK
LSLKSMLAVRTSYQGKPNGAIGLHQYDSFRHWTSEEINFIESVAAQLGIAIAQANLLEQE
KQQRQELALQNHALEKAKLEAESANRAKSHFLSKMSHELRTPLNAILGFTQVMARDESMT
PEHKEYLGIINRSGEHLLELINDILSMSQIEAGQVTLNQNCFDLYRLLDSLEEMLGFKAT
SKGLKLIFERASDVPRYIQTDDSKLRQTLINLLGNAIKFTHAGRVTLRVGMGSTGNQAGM
FPLSQCPLPHTRLWFAVEDTGPGISLEELSSLFDPFVQSATGRQSMEGTGLGLPISQQFV
RLMGGEITVISTPGQGAIFRFDIQIGLATTADEKPVSGKRQVMGLEPNQPSYRLLIVEDG
AVNRKLLVKILEPLGFEVRTATNGQEGVALWESWSPHLIWMDVIMPIMDGYEATQHIKQT
PKGQKTVIIALTANAFEEQQEAILKAGCDDFLPKPFQREVLLEKIAHHLGVRYVYEQQGT
PNLCQSPTPLQPMAPKALTVMPVSWVTELHQAALYADDELMKQLIEQIPLEYDSLRRALR
ALVDNFMLEQIINLTEPTKP
Download sequence
Identical sequences K9WA04
gi|428309070|ref|YP_007120047.1| WP_015180804.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]