SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428309074|ref|YP_007120051.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309074|ref|YP_007120051.1|
Domain Number 1 Region: 377-548
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.42e-49
Family Histidine kinase 0.00058
Further Details:      
 
Domain Number 2 Region: 592-732
Classification Level Classification E-value
Superfamily CheY-like 1.04e-40
Family CheY-related 0.0006
Further Details:      
 
Domain Number 3 Region: 305-387
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.43e-20
Family Homodimeric domain of signal transducing histidine kinase 0.00074
Further Details:      
 
Domain Number 4 Region: 767-972
Classification Level Classification E-value
Superfamily PP2C-like 0.00000706
Family PP2C-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428309074|ref|YP_007120051.1|
Sequence length 974
Comment serine phosphatase RsbU, regulator of sigma subunit [Microcoleus sp. PCC 7113]
Sequence
MKNHVFPYVAASLTAASILALTWVINHSEQDRFHQRNRADVLNQLSAVRARLEGKLNQRL
FLSRGLVAYISTINPDIDREKFDNLSKVIVAQQTGIRGVALYKNTVVTYMYPLAGWEKAI
GFDPMTIPAEREAIKRAIRTKQSIFAGPINLVPTGVGFVSRTPIFLTPPNAAAESGRFWG
MVGIIIDRDTLFKEAGLIDSQANLQYAIRGKDGLGVAGEVFFGDGKIFQQQPETSEVTLP
NGSWQLAAVPIGGWPKSAPTSQWFWLGGGLLAFLAGGLVFILVSAPAQLRKAVERATAAL
RESEEALLQANADLQRLDKLKDEFLANTSHELRTPLNGIIGIAESLMDGVTGSLPPATRF
NLSLIVSSGRRLATLVNDILDFSKLKHETIELQLKPVEMRSLAEVVLTLCQPLIGQKNLQ
LINHISPDLPAVSADENRMQQILHNLVGNAIKFTDSGTVEISAELIGQGNPNPQMAITIS
DTGIGIPEDKYDRIFESFEQADGTTARQYGGTGLGLAITKTLVELHGGKIGVESTVGVGS
RFTFTLPLAEQLSAKPEEGLKVGKLRIESSPELNVESSSQPAHLPPTNLQPVIFDGSKIN
ILIVDDEPVNRQVFANYLALHNYGINQASNGLEALALLERGLKPDLVLLDVMMPRLTGYE
VTRKIRETWQANELPVLLLSAKNQVSDLVVGLEVGANDYLTKPISKDELLARIKTHLNIQ
KLKAENLRLAAELDITRQLQQMLLPRERELGTIAGLDIAGFMEPAEEVGGDYYDVLKYNG
SLKIGIGDVTGHGLESGVLMIMVQTAVRTLLCNNETDPTQFLSTVNRTIYDNVQRMNSDK
NLSLSLLDYQQGQLCLSGQHEEMIVVRADGSLERVDTIDLGFPIGLEEDIADFISHTQVQ
LHPGDVVVLYTDGITEAENLGGEQYGIERLCAVVRDNRQQNAEQIKQIVLENVRSHIGKQ
KVYDDITLLVLKQK
Download sequence
Identical sequences K9W8D9
gi|428309074|ref|YP_007120051.1| WP_015180808.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]