SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428309214|ref|YP_007120191.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309214|ref|YP_007120191.1|
Domain Number 1 Region: 218-482
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 6.05e-19
Family SGL-like 0.073
Further Details:      
 
Domain Number 2 Region: 461-681
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 4.9e-18
Family SGL-like 0.032
Further Details:      
 
Domain Number 3 Region: 66-246
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000000000000301
Family SGL-like 0.072
Further Details:      
 
Domain Number 4 Region: 863-993
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000436
Family PYP-like 0.061
Further Details:      
 
Domain Number 5 Region: 1223-1333
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0000000000117
Family Histidine kinase 0.027
Further Details:      
 
Domain Number 6 Region: 1001-1119
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000134
Family Heme-binding PAS domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428309214|ref|YP_007120191.1|
Sequence length 1336
Comment signal transduction histidine kinase [Microcoleus sp. PCC 7113]
Sequence
MKVSIVFDWCYQDDEISCQIRQWLKNTILNFILTIIILLSLPTFVYAAEANPTFEHITAD
QGVSQSGLNSIFQDSQGFMWFGTQDGLNKYDGYDFTVYKYNALDAYSLSDNFITSIYEDK
SGIMWIGTDGGGLNKFNRETENFTRYIHDVDNPKSLSHNRVLSIYQDRFGTLWVGTDGGG
LNKFDRENEQFTHYQHHLNDPNSLSNDIIFSIYEDKLGTLWIGTGGGGLNKFNRKTGQFI
HYRNNPSDPSSLNDDTVLSIHEDQSTKLWIGTKNGGLNEFDRESGRFFHYTHDPDNPNSL
NHNTINSMAEDQLGNLWLATSSWYGNSYGSGLDKFVPKNGQFIHYKHDSKNPQTLSDNLV
ISLWVGHDQILWIGTAFSGLNKLDLKEPKFLHYKNDPAKLNSLSDNHVMSIDEDHFGQLW
IGTSDGGVNKFDSQTGKFTHYTHNSANSYSLSSNNIWSTYEDRNGMLWVGTFGSGLDKID
RKTQKITHYQHNFNKPYSLSDNTVTSIHEDYLGTLWIGTMRGGLNKFEPESEQFTHYTND
PSNPNSLSDISAFLIYEDRAETIWIGTLNGGLNKFQRETENFIHYKHDPKNPNSLSYDRI
VSIYEYPSGTLWIGTFGGGLDKFDIATETFTHYTEKNGLPNNSVVGILADDEGNLWLSTG
KGISKFNPKTETFRNYDVSDGLQGNEFDGVKAYLKSKTGEMFFGGLNGFNAFYPDQVKDN
PHIPPIVITDFKKFNESVKLKPSIFEIQSIKLSYKDNFFGFEFAALDYTNPLKNQYAYKL
EGFDKDWIYSGIRRYASYTNLDGGTYIFKVKGSNNDGVWNEKGTSIKILITPPPWKTWWA
YTLYIMAVVTVVIGYVQWKTRAQKKENALLRESERKLNQFLEAIPVGIGVIDQAGQFIYV
NQIGLQLQGIEALLKPPIQLFSETCQAYVAGTEQLYPTEQLPLVRALRGEKITLDDLEIH
QSDKIVPLQVWGTPIYDEQGAILYAIVAFQDITSRKQAEAERQDYIEALQQAKDQLQAVI
DTVPGCVCWMSSDGRYLGVNRHLADTFKLSPDDFIGREIGFFLTDSLLSELIHQFLASPE
LSTTQVIKLSVQDSIRSYLMSVQKYHRNTAAVSVAIDITDRMFAEEALRASLREKEILLQ
EVHHRVKNNLQIICSLLDLQSQTLNDEKTLAVFQESYNRIKSMTIIHEKLYQSTSVEKIN
FAEYVETLMNHLLLSYKVDSELIQVYSNIEPIYLNIDTAIPCGLIINELLSNSLKHAFPN
SAKGLINLYFKFDRNKRFTLIVKDNGVGFPKDFNIQEKSTLGLKLVKVLTQQLEGNIELK
QEQGIELAISFPNIKA
Download sequence
Identical sequences K9W8Q3
gi|428309214|ref|YP_007120191.1| WP_015180945.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]