SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428309229|ref|YP_007120206.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309229|ref|YP_007120206.1|
Domain Number 1 Region: 303-497
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-48
Family Ribonuclease PH domain 1-like 0.00000616
Further Details:      
 
Domain Number 2 Region: 4-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.72e-43
Family Ribonuclease PH domain 1-like 0.0000286
Further Details:      
 
Domain Number 3 Region: 460-559
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.4e-26
Family Ribonuclease PH domain 2-like 0.00011
Further Details:      
 
Domain Number 4 Region: 143-229
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.53e-26
Family Ribonuclease PH domain 2-like 0.0017
Further Details:      
 
Domain Number 5 Region: 565-650
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.52e-22
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Domain Number 6 Region: 230-335
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 3.79e-20
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0031
Further Details:      
 
Domain Number 7 Region: 630-713
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.79e-17
Family Cold shock DNA-binding domain-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428309229|ref|YP_007120206.1|
Sequence length 717
Comment polyribonucleotide nucleotidyltransferase [Microcoleus sp. PCC 7113]
Sequence
MVELDKSISFDGRDIRLKVGLLAPQAGGSVLIQSGDTAVLVTATRAQGREGIDFLPLLVD
YEERLYAAGRIPGGFLRREGRPPEKVTLTSRLIDRPLRPLFPSWLRDDIQIVATTLSMDE
QVPPDVLAVTGASIAVLQAKIPFYGPMAAVRVGLVGDDFIINPTYREIESGDLDLIVAGS
PDGVIMVEAGANQLPEQDIIEAIDFGYEAVRDLIEAQRELMASLGIEVTIAEPPVGDTTL
EQFIRDRATTQIKGILSQFDLDKHSRDTALDEIKANSVVAAIAELPEDEPVRVAATEDDK
AVGKIFKDITKQLMRRQIVEEGVRVDGRKLDEVRPVSCKVGLLPQRVHGSALFNRGLTQV
LSTATLGTPGDAQKLDDLNPEEDKRYLHHYNFPPYSVGETKPMRSPGRREIGHGALAERA
IVPVLPPQEDFPYVLRVVSEVLSSNGSTSMGSVCGSTLALMDAGVPLTKPVSGAAMGLIK
EGDEVRILTDIQGIEDFLGDMDFKVAGTDTGITALQMDMKITGLSMDVISEAIKQARPAR
LHILEKMLVALDKPRTELSPFAPRLLTMRIDPDLIGLVIGPGGKTIKGITEQTGAKVDIE
DDGTITVSAVDGEKAKKAINIIQGMTRKLNEGDVYSGRVTRIIPIGAFVELLPGKEGMIH
ISQLADYRVGRVEDEVAVGDEVVVKVREIDSKGRVNLTRLGIHPDEAAAAREAAAMT
Download sequence
Identical sequences K9W8S1
gi|428309229|ref|YP_007120206.1| WP_015180960.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]