SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428309262|ref|YP_007120239.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309262|ref|YP_007120239.1|
Domain Number 1 Region: 1141-1445
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.75e-84
Family WD40-repeat 0.0000106
Further Details:      
 
Domain Number 2 Region: 1461-1758
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.79e-71
Family Quinoprotein alcohol dehydrogenase-like 0.034
Further Details:      
 
Domain Number 3 Region: 555-627,755-873
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000203
Family G proteins 0.037
Further Details:      
 
Domain Number 4 Region: 341-475
Classification Level Classification E-value
Superfamily TPR-like 0.00003
Family Tetratricopeptide repeat (TPR) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428309262|ref|YP_007120239.1|
Sequence length 1797
Comment WD40 repeat-containing protein [Microcoleus sp. PCC 7113]
Sequence
MREPNRIQEVAVLNERSLSTLSRAITLSEGHFALILVRCNYEVCKEQMRQRLQALTGVTL
SELVLRKAIKSLYRPIVSILSGTQASALIVFGLESVTAIDQVLISTNQIREEFRKNLTRP
LVLWITDEVLQKLTRFAPDFKSWAATSIKFELTTTELLALWQQTTDELFTRLLGSDLSEF
LSNDALNLAPGCRQRQELESVLRDLTTRGVYLEPEQWATWQFILGRDALTRDQLDVALVQ
YQKSLDVWLPEDQSGAVWEQGNNASMFAFIQGEKAYTGAQENLSHPTSQTHPQDVNAAQR
SLVRGRHNPKSLERVGLLFHHIGLCHCRQAELQPLTSRIQWEQAKESFSKAIEVFTLARR
QDLVAQLTLHLGQVLKQLESWTELQALALHALEDPQTQDSPVQLAQAYGFLAVVALAQFE
WENAKYLAWGAFDLLAQSGSPQPLHRGGYLLYSAKAQRQLGELTPAITNLEQAITAEYWS
PTALKKQPQLYIDILEELRSLYLEQRQYWRAFELKQRQRLIEQQYGFSTFLGAAPLQPFT
RQGRGISSLEIAAAGRQSDVNRLIERLSRNDHKLTIIHGSSGVGKSSLINAGLVPALASR
IIGAREAMPIVQKAYRDWLGELERRLEAALASRQVKGLNSSKEEFSPELELKIRQSVYDE
SAQCSTPNPAQVQPATLGGEETPPVSAEEAATLAENLLRSQTLALALSVARLREAQSQTL
NQSPIPSFQPSISSPRLQQILKQLRVAAEHKLLTVLIFDQFEEFFFCTNLEQRREFYEFL
AQCLNLPFLKVILSLREDYLHYLLECERYCNLSTINNNILDRQLRYHLGDLSPDDARNVI
STLADVSQFQLEESLIAALVRDLAGSTGVVRLIELQVVGQQLQTEKITTLEQYYALGADP
KATLVERSLLGVINDCGQENEDTVWQVLFSLTDERGTRPLKTIPELAVGTGITPKCFTEQ
CLTRCDGSQAQLIPKKLDLILKILVGSGLVFRVPEEQQDRYQLVHDYLVEPIRQKYNQLA
HLNVVAKLERSEQALVQAHQQRLRASIIGATMALLAITTGGLGWRAEVQRRLATNLSINA
QLSAISASSEALFVSNKKFDALLEGLRAARRLKDLETAERSVEPDTHLQVVTALSQAVYS
TAERNRLEGHSDIVWNVSFSPDGQLLASASQDHTVKLWRPDGTLVATLNRHNDSVTSVSF
SPDSQMMASSSKDGKIRLWRRNGSLVSLLRGHVGPVYSVSFSPDGQLIASAGGDGTIRFW
TLKGKLIQTLYSDHGVVRWVSFSPDGERVASARQDGTIELWSRQGKLLQTLKGHNRQVNG
VVFSPDGQFLASASDDKTVKLWNRNGKLIKTFSKHQGWVMAVAFSADGQFLASASADNTV
RLWNRNGTLRQTFTGHSDIVTSVSFSPTPVSGLPGESSKTTLQSSTFNSVPLLASASNDK
TIRLWGLNNPSRLILPVQKQVREVSFSPDSQLIATAGDDKTVQLWTRNGKLLHTLKGHKE
RIDSISFSPEGQLLASASRDGTMKLWTRGGLLLKTITGHQGWVLSVSFSPDGKRLASTGQ
DGTVKLWTRQGVLIKTLSEHRDSLHPDALNSKTANGENRSDFRVNAVAFSPDGELLASAG
DDKTVKLWTADGRLLKTLRGHSNWVLDVSFSPDSQMIASASYDNTVKLWSRQGEMIRTLK
GHSDSVAHVRFSPTGQILATTSWDNRIQLWRLDDTLIKTLEGQQDRVTSVSWSHDGKALA
SASRDNTVMVWNFNLEHLLDQGCNWLRYYLQNNPKVRHRDRELCQSLERPQDQTPKG
Download sequence
Identical sequences K9W9B3
gi|428309262|ref|YP_007120239.1| WP_015180993.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]