SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428309308|ref|YP_007120285.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309308|ref|YP_007120285.1|
Domain Number 1 Region: 3-268
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 7.07e-65
Family Decarboxylase 0.00049
Further Details:      
 
Domain Number 2 Region: 292-479
Classification Level Classification E-value
Superfamily PRTase-like 8.47e-41
Family Phosphoribosyltransferases (PRTases) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428309308|ref|YP_007120285.1|
Sequence length 483
Comment orotidine 5''-phosphate decarboxylase [Microcoleus sp. PCC 7113]
Sequence
MDFFEKLNAAIAQNQSLLVVGLDPNPEMMPTHYCGGEDKDSLIEDLWDWLQFLIGETSDL
VCAYKPTFGFYKALGVPGMELLHKTLTAIPAHIPIILDAKHGDLNTSTIFAQTVFTQWQV
DAITLTPYSGQDHIAPFLIYPGKAVFVLCSTSNPGAVSLQQYPTPESPLYLQVVKEAKNW
GTPEQLALEVGTTNAEIMARIRAVAPERIILARSIWAEGGGNLSEILAAGLNDNGDGLLI
PVPQDILSSEKPAVAIEPLRQSINQTRQQIVQDGTTCDLWMPDVCFLEQHPYQDLILQLY
DIGCILFGEFVQASGAVFPYYIDLRKIISNPQIFHQVLTAYEHILKDLTFDRIAGIPYGS
LPTATGLSLRLNHPMIFPRKEVKAHGTRRVIEGHFEPGEMIVVVDDILISGKSVMEGAEK
IKSAGLKVEDIVVFLDHEQGVKDRLKANGYRAHSVLTISEITETLYQAGRISEEQFQAFA
QSH
Download sequence
Identical sequences K9WAS6
WP_015181039.1.75295 gi|428309308|ref|YP_007120285.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]