SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428309353|ref|YP_007120330.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309353|ref|YP_007120330.1|
Domain Number 1 Region: 4-269
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.01e-53
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 1696-1861
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.23e-32
Family Histidine kinase 0.0077
Further Details:      
 
Domain Number 3 Region: 1390-1580
Classification Level Classification E-value
Superfamily GAF domain-like 4.58e-26
Family GAF domain 0.0053
Further Details:      
 
Domain Number 4 Region: 302-318,377-628
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.33e-16
Family Extended AAA-ATPase domain 0.084
Further Details:      
 
Domain Number 5 Region: 1604-1671
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000235
Family Homodimeric domain of signal transducing histidine kinase 0.0067
Further Details:      
 
Domain Number 6 Region: 1280-1347
Classification Level Classification E-value
Superfamily TPR-like 0.00000199
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 
Weak hits

Sequence:  gi|428309353|ref|YP_007120330.1|
Domain Number - Region: 1098-1138
Classification Level Classification E-value
Superfamily PX domain 0.0327
Family PX domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428309353|ref|YP_007120330.1|
Sequence length 1863
Comment ATPase [Microcoleus sp. PCC 7113]
Sequence
MNALTDYQILAKIYESANSLVYQASLNQNNQPIILKVLKEDYPTPSELTRYKQEYEITRS
LNLDGVVKVYDLQRYQNSLAMLLEDFGGESLKSWMTKRKFTLEEFLTIAIKIAESLGAIH
AANIIHKDINPSNLVYNPETGQIKIIDFGISTVLSRENPTICNPDRIEGTLAYISPEQTG
RMNRAIDYRTDLYSLGVTFYELLTHQLPFTTHDAMELVHCHIAKQPIAPHELVGTQVGAP
LPTIVSEIVMKLMAKTAEERYQSAWGLKADLETCLHQLQTTAQISEFSLADQDVSEKFQI
PQKLYGREEEVKTLLSAFDRVAAGVDLTSPSVLLDPPHSPRNGGRTEDETFYAREESQIP
PLKKGGQGGKEGGLGHSELILVAGYSGIGKSALVNEIHKPIVQQRGYFIAGKFDQFKRDI
PYASLIQAFQDLARQLLTESEAQLEIWKQKLLNALGSNGQVIIDVIPEVELIIGEQPSVP
QLGSTESQNRFNLVFQNFIGVFTDKQHPLVIFLDDLQWADSASLKLIQLLMTDPDSQYLL
MIGAYRDNEVSPTHPLMQTLDQIQQTGTRVSTITLQPLSVDCVNQLIADTLNGSIERSNP
LAQLAFNKTNGNPFFLTQLLQFLYTENLLSFDFITGGWQWDIEQIQAVGITDNVVELMIG
KIEKLDEKTQNVLKLAACVGNRFDLDVLSVVNAKSLSETAAELWSALQEGLIVPLSDDYK
IPLLWNQEIESRNNSEATPSFIPNFSSSIPYKFLHDRVQQAAYTLIPEDHKKEVHLKVGQ
LLLQNTQLDELAENIFDIVNQLNIGAELLVQQSEKDELARLNLIAGKKAKASTAYEPALR
YLETGLELLTFGSWQEQYSFTLELHIETVEAQFLNTQFEKAEKLSVFILENAKSLLERVK
VYELNIQSYIAKQQYNEAIDTALEVLAKLGVDLPSKPDKQRIEEEQKTLKLLLGDKQIED
LANLPDMTNPHHLASVRILMSIAAATVVVNPDLYPLVTLTAVNLCIKDGNPPQAAGVYVF
YGGLLCGVMEDIDSGYRFGKLSLKLLERFNVRKALVIHFYNGYIQHWKESLKDTLELVLE
GANNGLETGDYEFACYDAVSYCLQMFFAGYNLKKVEQKYSEFIIFIRKLKQKYPSNYIKI
SSEIALNLIHGAKNQYYLIDDCKAKEDIYIKTWIQESNVWLLFLTYLGKTILSYFFKTYE
QAVENAIEAEKYLDSCRQYIIGGPYIFYYSLALLAQYPISKTHKQKQFLKKVSSNQKLIK
EWAYHSPANYQHKYELIEAEKARILGKSAKAMELYDRAIKGAREQGFIHEEALAYERAAE
FYLSLGREEIGQFYLKNAYQCYVNWGAVAKFKALEAEYPKILVGTTNRKSSKNTSTIVTT
SESEAQALDLSTVIKASQTLTSEIVLGKLLSKLMKIAIENAGAQKGFLILDNNGKWVIEA
EGVVGKDEVNVMHSISVDAVDSTTQVPLVSTAILNFVAHTQENVVLNNATHEGQYTRDPY
IMATQPKSILCAPLLNQGKLSGILYLENNLTTGAFTSDRVETLRILSAQAAISIENSRLY
NQLEEYNRTLEFRVEERTQQLQEKNQELASTLKKLKATQDQIIAQEKLASLGALTAGIAH
EIKNPLNFVNNFAELSAELTEELLEEIGNQKENLDTETTEYIEEILNDLTQNVKKINEHG
KRADNIVRGMLSHSGGKAGERQLTDINALLAEYVNLAYHGMRAKDSSFNITIETHYDDTI
GSINVVPQNISRVFLNVINNACYTTHEKKKELGDRFMPTLSVSTKNLDEQIEIRIRDNGK
GIPDEIRDKIFNPFFTTKPTGQGTGLGLSISHDIIVQEHQGELKVNTSPGSYSEFVIVLP
KRS
Download sequence
Identical sequences K9WAX2
WP_015181084.1.75295 gi|428309353|ref|YP_007120330.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]