SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428309356|ref|YP_007120333.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309356|ref|YP_007120333.1|
Domain Number 1 Region: 727-912
Classification Level Classification E-value
Superfamily Nucleotide cyclase 5.81e-54
Family Adenylyl and guanylyl cyclase catalytic domain 0.00027
Further Details:      
 
Domain Number 2 Region: 373-541
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.96e-48
Family Histidine kinase 0.00058
Further Details:      
 
Domain Number 3 Region: 575-700
Classification Level Classification E-value
Superfamily CheY-like 6.26e-39
Family CheY-related 0.00054
Further Details:      
 
Domain Number 4 Region: 3-151
Classification Level Classification E-value
Superfamily CheY-like 3.7e-34
Family CheY-related 0.0012
Further Details:      
 
Domain Number 5 Region: 300-383
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 6.67e-21
Family Homodimeric domain of signal transducing histidine kinase 0.0007
Further Details:      
 
Domain Number 6 Region: 154-287
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.79e-18
Family PYP-like 0.023
Further Details:      
 
Weak hits

Sequence:  gi|428309356|ref|YP_007120333.1|
Domain Number - Region: 925-964
Classification Level Classification E-value
Superfamily TPR-like 0.0379
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428309356|ref|YP_007120333.1|
Sequence length 971
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MPAKILVVDDEPDLESLIRQKFRKKIRQNELQFVFAQNGVDAIEKLQTEPDIDMVLTDIN
MPQMDGLALLTRLSEQHPTIKTVILSAYGDIENIRKAMNLGAFDFLTKPIDFQDLEITTN
KTLQHVEQMKQSLQKERLAQQAQAELLKNLQQEIAERQRAQEALRISERRLAQFLEALPV
GIFVVDSSGQTYYANQTAQELLGKAIAPDATAEQLPVVYQAYVAGTQQIYPVDQQPIWRA
LKGERANVDNMELHQGDRIIPLEVWATPIFDETDQVVYAIAAFQDITQRKQAETERISFT
QELEFKNTQLQRLDQIKDEFLANTSHELRTPLNGIIGIAESLLDGAAGELNDRQKANLSM
VVSSGMRLANLVNDILDFAKLKNRDIELHLQPIDFRQITEIVLRVCRPLVTSKSLALNNE
IPEELVAVEGDENRLQQIMYNLVGNAIKFTESGSVTVSAIALDSMVEVTVADTGIGISPD
KFGDIFKSFEQVDASVSREYGGTGLGLSITKQLVELHGGTIHVESELSQGSRFIFTLPIS
KQPPNRTLDLSQALARMRENESPPPELLAPIVQSEGQLTILVVDDEAINLQVVANHLSLQ
NYGIVQASSGIEALEKIHNGLRPDLILLDIMMPKMSGYQVCQKIREQFPASEMPVVMLTA
KNQVSNLVAGLDAGANDYLTKPILKNELLARIKTHINLSKINIAYGRFVPHEFLRFLGHK
SIVDVRLGDQILKEMSVMFADIRDFTTLSEEMSPKENFDFINSYLSWVGPVIRQHNGFID
KYIGDAVMALFPETADQAVNAALDMQKQVLLYNIKRQKSGYPTLAIGIGLHRGSLMLGTI
GEERRMESTVIADAVNLASRLEDLTKVYGASILISGPTLFSLEDPTLYHYRFIGQVQVKG
KKERVSVFEIFETDPPQLQALKQQTKTLFEEAIILFNENKIAQAYQIFKQIHQINSQDKA
ASFYIKMCEQR
Download sequence
Identical sequences K9WBM8
WP_015181087.1.75295 gi|428309356|ref|YP_007120333.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]