SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428309422|ref|YP_007120399.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309422|ref|YP_007120399.1|
Domain Number 1 Region: 356-528
Classification Level Classification E-value
Superfamily GAF domain-like 1.09e-59
Family GAF domain 0.0000528
Further Details:      
 
Domain Number 2 Region: 883-1048
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.6e-42
Family Histidine kinase 0.0014
Further Details:      
 
Domain Number 3 Region: 7-93
Classification Level Classification E-value
Superfamily CheY-like 4.13e-24
Family CheY-related 0.0079
Further Details:      
 
Domain Number 4 Region: 695-805
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.77e-20
Family Heme-binding PAS domain 0.019
Further Details:      
 
Domain Number 5 Region: 219-346
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.89e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.038
Further Details:      
 
Domain Number 6 Region: 570-693
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 8.38e-18
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.033
Further Details:      
 
Domain Number 7 Region: 811-895
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 3.53e-17
Family Homodimeric domain of signal transducing histidine kinase 0.0044
Further Details:      
 
Domain Number 8 Region: 118-182
Classification Level Classification E-value
Superfamily CheY-like 0.00000289
Family CheY-related 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428309422|ref|YP_007120399.1|
Sequence length 1061
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MRHKANVNILLVDDQPHYLLELEAILESLGHNLVKADSGEQALRYLLNQEFALILLDVQM
PEMDGLETAKRIRDTPNGHHTPVIFIADSSSAQTGESSGETQRKYARGKPSKPHPQSHPS
DTEVLKAYALGAVDYLFKPLVPEILRSKVTAWISLFQETQVLRQRTAQLEAAMQQLQQES
AQGKQAELALQELNQQLELRVQQRTAELQQANERLQAEVEERRQAAAALRTSEARYKAIV
QNSYDIITFTDEQDNIYYQNSTRERILGYPVTESSCKRPAHEVHLDDISKVQAAMSAILA
QPGMPVTVEYRMKRADGSWAWLESVATNWLSNPDIRAIVANSRDISEHKQAQEVLRQRTQ
RERLISASIQRIRETLDLDVILSTTVEEVRQFLQVDRVLVYRIWPDSTGSTIAESVVPGC
LRILGHTFPPEVFPPEFHHWYCQGRVRAIVHPETDQVSPCLIDFLKEWGVKSKLVVPIVY
QGELWGLLIAHHCSQPRQWQPLEMDLLQQLAIQLAIAIHQANLYQQLQLKLAERKEAENA
LRQARDQLEIRVIERTAELTRINASLQAEIRERIAAEQALRTSEERFRVALKNSPTTVFN
QDIDLRYTWLYNSLFGFSFEQVVGQLDCELFGTEDGQRLTAIKRQVLTTGVGSREETSMT
INGEIRHYDLTVEPLLGSNRDITGITCAAMDITEILAREQQLRAIFESSLDAIAIIDNQG
TYVEVNPAACQLFNRPLAELLGQSIADLIAPDCDFKRVWRTVVVLGQGRGELRLLRPDGS
VRDVEYAAKASFLPGRHLAVLRDITERKQTEEIRRALAAEQELRRVQLRFFSMVSHEFRT
PLSTILGSAQLLKSYTPAWTEEKKLRNLSRIETAAKNMTQLLDDLLTINRAESGKLEFHP
QPINLEKFCRSLIEDLQLNADPKHQICLTIQGSCPTASVDEKLIRSILNNLLSNALKYSP
QGGEIHLVLICSKKEAIFQIKDAGIGIPLEDQSHLFELFHRGKNIANITGTGLGLSVVKQ
CLDLQGGEISIDSQVGVGTTVTVKIPLASARCSLTQLKMNQ
Download sequence
Identical sequences K9W9R5
WP_015181153.1.75295 gi|428309422|ref|YP_007120399.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]