SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428309455|ref|YP_007120432.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309455|ref|YP_007120432.1|
Domain Number 1 Region: 1537-1720
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.06e-38
Family Histidine kinase 0.00076
Further Details:      
 
Domain Number 2 Region: 1745-1870
Classification Level Classification E-value
Superfamily CheY-like 1.85e-36
Family CheY-related 0.0037
Further Details:      
 
Domain Number 3 Region: 1104-1218
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.06e-24
Family Heme-binding PAS domain 0.003
Further Details:      
 
Domain Number 4 Region: 1467-1549
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.16e-23
Family Homodimeric domain of signal transducing histidine kinase 0.00088
Further Details:      
 
Domain Number 5 Region: 1332-1460
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.97e-23
Family Heme-binding PAS domain 0.065
Further Details:      
 
Domain Number 6 Region: 697-826
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.22e-23
Family Heme-binding PAS domain 0.087
Further Details:      
 
Domain Number 7 Region: 950-1078
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.2e-22
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.023
Further Details:      
 
Domain Number 8 Region: 1207-1333
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.36e-21
Family Flavin-binding PAS domain 0.083
Further Details:      
 
Domain Number 9 Region: 563-698
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.25e-18
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.04
Further Details:      
 
Domain Number 10 Region: 824-944
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.5e-16
Family Flavin-binding PAS domain 0.067
Further Details:      
 
Domain Number 11 Region: 460-567
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000647
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.075
Further Details:      
 
Weak hits

Sequence:  gi|428309455|ref|YP_007120432.1|
Domain Number - Region: 381-429
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000314
Family HAMP domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428309455|ref|YP_007120432.1|
Sequence length 1958
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MPIPTISPLVKKVLRKLPLRLVLTLPFVLQTVGAVTLVGYLSYRSGQQAVADLANQLMQA
KGDRIVQSLEQYLKTPKDLVRENQAAMKLGILDWQNTSLIETYFVEQLKIHTDVSSLVIG
TERKDFLSVTRPHPDRFTIRQRNPETGALENYAADLQGNRLYLQDTLPNYEPHADPPTRP
WYKVAKDSKEGHWQLVVSLVRGKEQPLLLLAYFLPFVDPLGQFQGVLSGSVFLDQTGEFL
HRLQIGKTGQAFIMDEKGLLITTSTTEEPFHLNRSIEPKETLPPEVLRLAAKDSQNPVTR
TAAAWSVKPDAHPMGFRLQNKSYFGRVIPFQLDNQIRWTIVVVVPESDFMAQIQANIYRT
LMLCGLALLGAISSGIWTSKRISRSLFRLTQATETVAVGTLDTPLPVTRIAEVESLTASF
RQMVMALQEANQLRQNYAQDLERQVALKTAALTEAQHIAKVGSWEFDLAKQEVIWSQELY
RIYEAEEQAPVPRPDLTIQQIHPDDQERFQREVVEAMIAPGFFDTDLRIITQKGNIRYIH
AKGQPIYNAQKEVVKWVGTVADISDRKVTELALQAQEQQLSSIAANIPGGIYRAVYSADG
NLLSLYLSDSYRQLLGYDPNELLQDPGGLNNALNLIHPDDRPKFFQALQLAGQTLEPVQL
EYRLMTASGEGKWIIDHARFQKGEQGELIVDGVDIDISDRKLAEVALQQSEERFQEIAST
INQFFFVRCAKSQQFLYVSPAYEKIFGSTCESLYKNSDSWLEAIHPDERQQIIASLSQQF
QGHSVRREYRIIRPDGAIRWIYAQILIVRDEAGHPLRYIGFADDITERKQAEENLQRYER
IVSATADGIALLDRNYIYQVVNQTYLIWHNKQYEEIVGHSVADLLGEDLYQNLVKECLDR
TVAGETVRYQAWFEFKAEPTKQRFLNVTYSPYYETDNTISGVVVGLRDLTQQKQAEDALR
QSEERLKYLLTASPAVIFSCKPEGDYRATFMSQNVRAILGYDAQEFLNSSQFWEMRVHSD
DLEGIVASLPQLFEQGSCTYEYRFLHADGTYHWLYTQLRLVKDEVGNPFECIGYLIDIND
KKRAELSLQASQSRFAGILEIANDAIITVDALQQITLFNQGAEKIFGYRADEVLGQPLDL
LLPSRVRDIHHQHVTAFSESVGTARRMAERGEIFARRKDGSEFPAEASISKLEINGEIIS
TAILRDISDRKHAEAALKHSEERYLAIIEDQTELITRFQPDGTLTFVNQAFCRYYAKSRS
EILNKRYQPFIFPQDLEKIRQFLDSLNVEKPLGTIEHRVIVAGEIRWMQWINRAIFDEQG
NFVEFQSVGRDITEQRKAQEALKNSERKFKGAFDTIAVGMCLVSIAGGFLEVNTALCQML
GYSESQLLSIRWQDIVYQEDQFQELECVERMYAGEQDGYQLEQQFVCQDGTVIWGLSSVS
LMRGIHQEPMYLIAQVTDITERKQAEIALQAAKEAAESANRAKSKFLANMSHELRTPLNG
ILGYAQILQRNKDTTPQQKKGVDIIQQCGEHLLTLINDILDLSKIEAEKLGLYPDDFNFS
AFLKGVFEIFCLKAAQKSIDFRYVTSNKLPTVVHADEKRLRQILINLLSNAVKFTDAGSI
TFKVEVIGSNKQDQLSINNPKSKIQNQLIRFQVEDTGIGMTSEQLEKIFLPFEQVGNSSR
YAEGTGLGLSITEKLVCLMGSQIFVESTPGVGSKFWFDLDLPVVSNPIESTLIKSTHTII
GYQGKKRKILIVDDRWENCAVLVNLLEPLGFELTKAANGQEGLEKAIEVQPDLIFVDLVM
PVMDGYEMTRQLRQFPAFQTTKIIAISANAFEADQLYTLESGCNDFLSKPLQTEELLHKI
KSYLDLTWISDPKKTGDGETLSINIVDATLPPMVIPPPEELLALSQAAMIGAISEVEQEI
IRLQQLNPEYTAFVTRVLQLAEEFEYEEIVNLVDCYLI
Download sequence
Identical sequences K9WB34
WP_015181186.1.75295 gi|428309455|ref|YP_007120432.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]