SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428309502|ref|YP_007120479.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428309502|ref|YP_007120479.1|
Domain Number - Region: 29-81,151-183
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.000481
Family HD domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428309502|ref|YP_007120479.1|
Sequence length 496
Comment hypothetical protein Mic7113_1182 [Microcoleus sp. PCC 7113]
Sequence
MDLEVAHTRCKDRLVWAIEQLQGKVEPTQLEIITELIIQTMTGPWRYFHTPDHIFEVGGS
VNAVEVLAALFHDLVYVQVDHGVSINIGSYIAPFVKEVKGIEVKEAKGKGAKGQLVIRES
SDMPASAMFDIVATIFGFSPNQVLSPMAGQNEFLSALIAARSLEPVLSPGVIAQIVACIE
ATIPFRPLSPSGLTPSEMLYQRLIAANQQFNFGWNEPQIIEIVKRCVRLSNRDVENFAYP
NSADFLDNTWNLLPETNHELIHANSYTVAGYRRSLQNMEGFMNFLSPEQVFQRFMGEPDD
ETYQELILKTRKNLEVAKLYLGCKLVSIAIIEALSRRLVGGRDRDIPLSTMMGELPIAGL
KTPSLEQFLPDIPSVHPPETPLEREVLELLRKGRNQDSSYDLKNSPIATFIVNAMGFPSV
RHLIQRAKEFFAGKLSTDEFLRECDYKAIRTVIDAVEQLFESRANALRGLSGETTLTFEP
YPAAISKLGQEVVSEV
Download sequence
Identical sequences K9WA29
WP_015181233.1.75295 gi|428309502|ref|YP_007120479.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]