SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428309577|ref|YP_007120554.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309577|ref|YP_007120554.1|
Domain Number 1 Region: 665-849
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.41e-42
Family Histidine kinase 0.0000131
Further Details:      
 
Domain Number 2 Region: 1038-1173
Classification Level Classification E-value
Superfamily CheY-like 2.13e-34
Family CheY-related 0.00087
Further Details:      
 
Domain Number 3 Region: 9-123
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 6.93e-25
Family Chemotaxis protein CheA P1 domain 0.0051
Further Details:      
 
Domain Number 4 Region: 850-995
Classification Level Classification E-value
Superfamily CheW-like 6.54e-22
Family CheW-like 0.0019
Further Details:      
 
Domain Number 5 Region: 514-568
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000942
Family Homodimeric domain of signal transducing histidine kinase 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428309577|ref|YP_007120554.1|
Sequence length 1179
Comment chemotaxis protein histidine kinase-like protein [Microcoleus sp. PCC 7113]
Sequence
MAINPNIRDQAYQFFIEEAPELLQILEAGLLTLRQEKNTAKVHALMRAAHSLKGGAASVE
LEAIKTLAHRLENIFKALYSDTVEIDTNLESQLLQAYDCLRLPLMEQIQTGYFDPEHALV
LAEPLFVQIEDKLGDALNQADTYIPSSSELGIDMAQSIFEVDVGEGLERLAEVVANPQNY
EVGGELRAQAEVFAGFAELLNQPGFGAIAHTAQLALDAYPERALTITQLALADFEFARQA
ILAAHAQSTNVKPISPSSALLALAHSDGTASQEQTKETVPALEDVLSIKLDENLSITPVP
EDIYNLEADGTLEDIFATAAPSLNPSVAETNRLDEVHHLEPDLALEAIFANAPELFEQPS
PTTEVPTHELDFCEIVDIESVTDEAVGDLPVVETGVDSAVVTSSSDAENELPITPFNIPS
LALENGEAAAQSIAQIFEQLPPVEEMPVLISRSNAASTTAENPPAINLVPTSSIPGELLP
TNAAHSPTPSPHPEVDRGSTDIPQGKASPVPTLSVRVDSERLERMNNVVGELAINRNGLS
LQNQQLQRSVRELLDRFVQVQGVVGHLRKLSDQMLATPERPQYEAILPAVNPLGDLVIRQ
ADFDSLELDRYGVLNSRLQELIEDMVQLEEAVDDVSLFAKQSNRTLEQQRQMLTQLRDEL
MWARMLPLSEVLNRFPRVLRDLSTNYHKSVTLNLSGTGVLVDKAALEKLYDPLLHLLRNA
FDHGIESPEIRRQQGKPEQGKIEIRAYHQGSQTIIEVKDDGQGLDTESIGKRAIELGLLS
AEQLATTSNNHLFELVFEPGFSTAKQVSELSGRGVGLDVVRSQMRSLKGSITVSSSPGVG
TTFTLHLPLTLTIAKLLVCLIGPTAIALPSDSVEEIVVPKSDQVKTTGEQRFLRWRDQIV
PAYRLADILDYTCPLPESAPSQALVSVPSPADWALPMLVLRQEEQVLALEIDRLVTEQEL
VIKPFGSAIAPPSFTYGCTILGDGSLIPVIDGTVLLDQLLGHNTTATRINTGSKPITLTV
NENSSINQTKTGITAPHAPTVLVVDDAVALRRTLALTLERAGCRVLQARDGREALEQLRQ
GSSRVNLVVCDIEMPNMNGFEFLGQRRQDPQLSKIPVVMLTSRSNDKHRWLAMRLGATAY
FTKPYLEQEFLVAIKHIIDEQKSQSTLESSRNSLQLQEA
Download sequence
Identical sequences K9WA99
gi|428309577|ref|YP_007120554.1| WP_015181308.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]