SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428309722|ref|YP_007120699.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309722|ref|YP_007120699.1|
Domain Number 1 Region: 259-335,366-451
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.91e-30
Family Histidine kinase 0.0037
Further Details:      
 
Domain Number 2 Region: 177-254
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000000392
Family Homodimeric domain of signal transducing histidine kinase 0.0017
Further Details:      
 
Domain Number 3 Region: 61-142
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000233
Family PYP-like 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428309722|ref|YP_007120699.1|
Sequence length 457
Comment signal transduction histidine kinase [Microcoleus sp. PCC 7113]
Sequence
MTLLAFLLGLAVGIGFCLWQRQRLQRQLEQMLGVLQTDSSSKALSAVSRLRQEIALANEH
RAKLEEKLQTGRRLLEVAPFGYLQVDEENRLLWCNEQARQLLQIDRWEPGQLRLLLELVR
SYELDQLIEQTRHQQKPTIQEWVFHPPCLDGEAMGDVQLLTLRASSWPLPHGQVGVFLEN
RQPLVELAQSRNQWFSDLAHELRTPLTSIRLVAEALQGRLENPARRWVEQLLHETNRLIN
LVQNWLELSNLEKNPSKSLTYQSVELRSLIQSTWQTLEPLAQQKQLCLAYFGLDTVWLRA
DEARLTQVFLNLFDNSIKHSFPQVTIQVEVTRLEAPAVDSEVEVRVDSFPLGNASNGLEG
ETSGSLIQIDIIDSGAGFTESDLPHVFKRLYRGDPSRQKSPSTSEPCTIAVSSGSGLGLS
IVQQIIQAHGGTVQAKNHPETKGAWLQIKLPDRKNLL
Download sequence
Identical sequences K9WAN4
gi|428309722|ref|YP_007120699.1| WP_015181453.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]