SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428309757|ref|YP_007120734.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309757|ref|YP_007120734.1|
Domain Number 1 Region: 308-472
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.7e-43
Family Histidine kinase 0.0004
Further Details:      
 
Domain Number 2 Region: 235-319
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 6.28e-19
Family Homodimeric domain of signal transducing histidine kinase 0.0012
Further Details:      
 
Domain Number 3 Region: 199-248
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000000262
Family HAMP domain 0.0041
Further Details:      
 
Weak hits

Sequence:  gi|428309757|ref|YP_007120734.1|
Domain Number - Region: 48-169
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00196
Family Sensory domain of two-component sensor kinase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428309757|ref|YP_007120734.1|
Sequence length 476
Comment histidine kinase [Microcoleus sp. PCC 7113]
Sequence
MDWSPIRIRWNSIYRKLLVTYVALTALGTSILAIYILWSFYGYFMKSRQADLDAWSAALG
ESIADALEEKDLDRAKLTVQRYGARESVTLRLFGADGHLLSTSAPEIDRQVSDWYAVAGV
KEALQNKFTHGVAKGILSNDDRLFVAKPIVRNGQMLGVLRMSITLDQFQRQFRSVIFTIL
GTLVFTVLLCAVISERLARNMARPIKAMSSFALQIGQGHLDGNLSIHQDDEIGQLATELN
RMSQRLASLEKERRAFLANVSHELRTPVSNVLVTVEALANGAIEEPELRDRFLHTAQDEI
SRLSRLIQDLLDLGRLEAGVTLLEEQPLRLQDLIDRAVRAVESRMRSQSVGIDVEIPSVQ
LYGDPERLLQAFLNILDNAIKHSIPNSTVFIVGKIESGQIGVQIRDQGPGISQSDLPHIF
EQFYTVDRSRQGSGTGLGLAIARRIVEAHGGSIVASSKGEGKGAIFTIHLPIDKLL
Download sequence
Identical sequences K9WAR4
WP_015181485.1.75295 gi|428309757|ref|YP_007120734.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]