SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428309785|ref|YP_007120762.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309785|ref|YP_007120762.1|
Domain Number 1 Region: 47-328
Classification Level Classification E-value
Superfamily Pectin lyase-like 1e-35
Family Filamentous hemagglutinin FhaB, secretion domain 0.011
Further Details:      
 
Domain Number 2 Region: 987-1094
Classification Level Classification E-value
Superfamily CalX-like 2.75e-17
Family CalX-beta domain 0.0013
Further Details:      
 
Domain Number 3 Region: 503-674
Classification Level Classification E-value
Superfamily Pectin lyase-like 7.33e-16
Family Pectin methylesterase 0.066
Further Details:      
 
Domain Number 4 Region: 762-983
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000000337
Family Pectate lyase-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428309785|ref|YP_007120762.1|
Sequence length 1574
Comment filamentous hemagglutinin family domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MNVFVKLFKEGLTILPLFGFSVCLTVLPTLPSVQAQPITPAVDSTNTIVTPNGNQINISG
GTSSGDGSNLFHSFEQFGLDAGQVANFMSNPQIRNILGRVVGGNPSLINGLIQVSGGNSN
LFLMNPAGIVFGASASLNVPASFTATTATGIGLGGNHWFNAFGNNDYPNLVGTPSQFAFD
LSQPGSVINAGNLAVSPGQNLMLLGGSVLNTGTVSAPGGTITLAAVPGENLVRISQPGHV
LSIEIESKTAGGQTIAFNPVNLPTLLTGTIGSGGVPSSAVPTEAGTIMVSGTLDASNSTG
GKIGGNVNVLGTNVNLVEANINASGSDGGGTVLIGGDYRGLGTVPNAEFTDVDSNTTLQA
NALTQGDGGKVVVWGNNTTTFQGQITAQGGAFGGNGGFAEVSGAQTLKYQGVTNLLAPNG
QTGNLLLDPETFIIANVGGDITPEGVAAALTTANVTFDATNFLTVSDAINSTSGFNLTLD
APTINLNAPITLGGQLLGTANNTTVNVGLAGRIQNGIDVATSGANVNLAPGTFTESVTIN
KSLTLTGAGAGNTTVSGNNTFRVFNISAANVTLDGLTITNGRADSGGGILYTGTGTLNIT
NSIITGNQAIGANGANGSNVGAGGGGGGGAGLGGGLFINGNGTVTVTNSTFAGNQAIGGN
GGQGFPNNGVFDGTGGNGGGANPGIGGTPGNPGGAGGFASGGGGGGGSDEVGGAGGAGGF
GGGAGGGGGRTGGFSGNPSNPPGFGGGTGGQGQFSAAGGGGGGAGFGGAIFVNSGSLSVN
NSTFVNNSSAGGVGGTGGFGGDGGAGQGTGGAIFVNTGNATLTNNTLSGNTASHSGGGIY
NLNGTTSLNHLTIANNTATLGNGGGLVNNGGTVNVRNTLIANNNHPTSPDVFGLFTDLGN
NLIGNSAGSTSFTTSTLVGTTTNPINPLLAPLQNNGGATQTHGLLPGSPALNAGATVTGV
TTDQRGVSRTGIGDPVPDIGAYEAIRVLFGNPTYSINTNATQAAIAVQVDRTPAIGTGGN
INVNYNTADGTAISGTDYSTTTGTLTFTNSVTRQTFNVPILSTARNNRTVNLSLTNPKNA
VLGSPNSALLTLLQPLPLPSPSPSPIPSPSPTPSPSPTPTTVNPVDLTLPQKPLEPAPIQ
NNNSQPLERAVESIDQSSSTDFEQYLGVGETPGISLVQARNLLRGIESSTGVKPAVIYAI
FVPESVTPSPASSQGLEEDSAELLLLRSLKPSPRDRLELILISGTGKPIRKSVNITRAEV
IAMAEKFRFTVTNARDALGYLTPARKMYQWLMAPLEADIEQRGIKNLTYITDSGLRTIPL
AALHDGKGFIVERYSIGLMPSLSLTDTRYGDIHSSEVLAMGASEFKDNKPLPAVPVELSV
ITQAWQGLSFLNQGFTLENLKSQRAKTPFGIIHLATHAEFLPGKPANSYIQLQDQKLAPL
QLKSVGWANPPVELLVLSACRTAVGDEEVELGFAGLAIQAGVKSALASLWYVNDEATLGL
MSEFYQQLKTAPIKAEALRKVQLAMISGKVHIQNQQLLTSEGEFPLPTELRGTGDRGFSH
PYYWSGFTMIGNPW
Download sequence
Identical sequences K9WC20
WP_015181512.1.75295 gi|428309785|ref|YP_007120762.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]