SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428309786|ref|YP_007120763.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309786|ref|YP_007120763.1|
Domain Number 1 Region: 196-250
Classification Level Classification E-value
Superfamily Hypothetical protein PA1324 0.000000262
Family Hypothetical protein PA1324 0.018
Further Details:      
 
Weak hits

Sequence:  gi|428309786|ref|YP_007120763.1|
Domain Number - Region: 66-266
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00408
Family Quinoprotein alcohol dehydrogenase-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428309786|ref|YP_007120763.1|
Sequence length 305
Comment hypothetical protein Mic7113_1481 [Microcoleus sp. PCC 7113]
Sequence
MKSLLPQLGSFELLFTAFLTAFFVAGASPLTAQTEIKNSASASGGNLPDVVQSNETVLTA
GQAVLQLVKTADRAAAEPGDTVIYRLALTNTGEVPANQITITDTPPLGVRFLPESLQGAL
TTGSTTTPVSLPPAVTADRQITFTYPRLAPGETLTVIYASVVTPDAVRGDGRNVARESRS
NLAAFQLRIRQGILSDCATIVGRVFVDKNFDGQQQPGEPGVPNAVLFMDDGNRITTDANG
LFSLVNVIAGHRTATLDLSSLPGYSLAPNIKFIEGNSQSRLVRLEPGGMARMNFAVTPAY
GEQQQ
Download sequence
Identical sequences K9WCT9
gi|428309786|ref|YP_007120763.1| WP_015181513.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]