SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428309788|ref|YP_007120765.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309788|ref|YP_007120765.1|
Domain Number 1 Region: 622-749
Classification Level Classification E-value
Superfamily OmpA-like 2.62e-31
Family OmpA-like 0.00047
Further Details:      
 
Domain Number 2 Region: 212-265,305-473
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.32e-20
Family Pectate transeliminase 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428309788|ref|YP_007120765.1|
Sequence length 776
Comment outer membrane protein/peptidoglycan-associated (lipo)protein [Microcoleus sp. PCC 7113]
Sequence
MRGVNRPASNLNKAEEGRQEAEVSQVCPSLVERKRNNKPFAWLFLSFDQKRPKAEDRRHE
KECPLPFAFYLPQLLLLSVLVAPLRATAQPTNSVSVVVNSNQDGLIQPDNRLTLREAIAI
VNGQLSLEQLSQAEKAQVRPLDANTASRIEFNLPPDQTTIYLQSLLPSLASPGLVVDGTT
QPGYDPTRSATAEIEIPIPVVALAPAPNQEVLRGLTIVADNITVRGLSLYGFGKWGGATL
NTPPGDIVIERSPAFPDVTLQPPTSSLDLRSPKPNSKPSESQPPKNVAIELNWLGIPPNG
QMPSQLSAFGLYVFNSLGTTIRRNRIANHQGSGIITGAQAENMLVTENIIVGNGLAGMPD
AIRLEGQIDQSQITGNLICGNDGSGVYLFKPKGAVQIRNNQITSNGRRLRQAAVYLMGNN
HQVMDNQISYQSGPGVVVTAYPQNDVQQNRSSSRNIIENNRFAQLEGLSIDLNTQQNVNP
IHFQRGDGPNPLRNSPNRREETGNAAINAPQFLSSEFFVLGTEVKLFGKADPGSTVEVYR
VRENTTIPYGPLSEPLTSVATDEQGDFSVTVDNLQPGDKVSAIATHPQYGTSEPALNARV
LAADGTGTAQPDVPSGVIPPCTTAQVPPNPPEPTPPPEQLRLSVARNIHFALDQSTISPE
SAVILDQIVAVMRSYPFLTVDIQGHTDPRASAAYNQALGMRRAIAARNYLLRQGIAPERL
TIRSFGELERRTTGSDVVDYARDRRVEFIFQDTRGLEIIFENQETDLQVEPRGGSR
Download sequence
Identical sequences K9WC66
WP_015181515.1.75295 gi|428309788|ref|YP_007120765.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]