SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428309811|ref|YP_007120788.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309811|ref|YP_007120788.1|
Domain Number 1 Region: 74-366,400-414
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.16e-34
Family Filamentous hemagglutinin FhaB, secretion domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428309811|ref|YP_007120788.1|
Sequence length 1416
Comment filamentous hemagglutinin family domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MFTVSGWLVTNPAKRKDPMISKGQPLCPLGIKVNWVHKAKNIGLSLLPWVVCLMCPWNIA
QAQSIVPASDGTGTIVTPNNNPQQFDIQGGTQSGANLFHSFSQFGLDQGQIANFLSNPTI
QNILTRVTGGSASYINGLIQVTGGSSNLYIMNPAGIVFGPNASLNVPASFTATTATGIGL
DNNQLFSATEPNNYATLVGQPSNFNFATSQTPGAVVNMGQLSVSQGNNLSLVGGTVVSTG
QLNAPGGQINITAVPGQSTVLLSAPGNVLSLEVPASEVSTITPSTLPQLLTGSGQSTGLA
VNSSGQVELTGSNIPIHNGDVVIKGSVTAQTATVSAQNNLILVESQLQTTGDLNLLAQNT
VMVRDTATNPFLAQAGGNLYIQGNYEIDILALNTPYIPPFQSGGNLSFVSDGIISFDSHS
QSGGSILFHNLSGGPANVYSYYDPIITSGGNIALGNYTGAALKVDSGGTITAGDITITQP
DTLSIPTTDPDYVILTTTPSLILKAAGSINVGNINTSDQSVGDAGHVRLTAQGNITTGDI
NARDLGAGNAGSVSLLSAGGNIQVENVNTTNLNAGNSGSITMIGAGTVTHGELNWNNFGT
GNQASSPVIMQNLGGTNTPPPTGGTTTPPPGGTTPPPGGTTTPPPTGGTTTPPPGGTTPP
PGGTTTPTPTGGTTTPTPPGGTTTPPPTGGTTTPPPGGTTPPPGGTTTPPPTGGTTTPPP
GGTTTPTPPGGTTTPTPPGGTTTPTPTGGTTTPTPTGGTTTPTPTGGTTTPTPTGGTTTP
TPTGGTTTPTPTGGTTTPTPTGGTTTPTPTGGTTTPTPTGGTTTPTPTGGTTTPTPTGGT
TTPTPTGGTTTPTPTPTGGSKTTPSSGSTTTTSGDSITTPAGGSKDNASGGSTNSTSNTC
LSCTSTDSTVTTPSGIANHQSSATTSTTSRSSTVATSDGSTPNSPNSGGANNPSGQGNTN
HVHLGGTSDSPTTSSSPQQLVGNSSSSEVKPNLVSSLEEPLTNQFEQYFGHPDKTPTVTL
ADARNILRKVEKATGVKPALIYATFVPQRIVANGVSNVSTPDQNSNLETPNSSYQLELVL
VTGEGEPIRRQVTGATRENVLQVVYQFQSEVTNAQSGRDYEAPSKQLYQWLIAPLDAEIK
ARGIQNLSFIMDSGLRSLPIAALYDGQQFLVEKYSLGLMPSLSLITDTNYKSIKDLQVLA
MGASKFPEKSPLPAVPVELSLITPSLWQGKAFLNDNFTLANLKEQREQKPFGLIHLATHA
TFRAGAPGNSYIEFWDTKLQLDQLPGLGWGNPPVELLVLSACKTALGDQQAELGFAGLAV
QAGVKSAIASLWSVSDEGTLALMTQLYQQLKVSPIKAGALQQAQIAMLRGQVSLKEGKLF
SGKETVPLPPELVKLGTRNLTHPYFWAGFTMIGSPW
Download sequence
Identical sequences K9WCW1
WP_015181538.1.75295 gi|428309811|ref|YP_007120788.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]