SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428309875|ref|YP_007120852.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309875|ref|YP_007120852.1|
Domain Number 1 Region: 29-366
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.57e-32
Family Filamentous hemagglutinin FhaB, secretion domain 0.0058
Further Details:      
 
Domain Number 2 Region: 706-753,787-817
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000785
Family Filamentous hemagglutinin FhaB, secretion domain 0.077
Further Details:      
 
Domain Number 3 Region: 935-1039
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000235
Family iota-carrageenase 0.09
Further Details:      
 
Weak hits

Sequence:  gi|428309875|ref|YP_007120852.1|
Domain Number - Region: 826-922
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000565
Family Filamentous hemagglutinin FhaB, secretion domain 0.068
Further Details:      
 
Domain Number - Region: 1020-1107
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000691
Family Filamentous hemagglutinin FhaB, secretion domain 0.064
Further Details:      
 
Domain Number - Region: 608-704
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0314
Family Filamentous hemagglutinin FhaB, secretion domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428309875|ref|YP_007120852.1|
Sequence length 1397
Comment filamentous hemagglutinin family domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MAIYLGRWGWGLGLAGVLLWGEANLFGSPTLAQITPDATLGAESSVVTPNVNVREFPADR
IEGGAVRGTNLFHSFQEFNVGNGQRVYFANPTGIENILSRVTGNNLSNILGTLGVDGGAN
LFLLNPNGIIFGSNAQLDIAGSFVASTANSVVFDNGFEFSANNPESPPLLTVNVPLGVQY
GTNQSRTTITNTGNLAAGQNLTLDAGNLDLQGQLQAGNNLTLQAQDTVKIRDSITNPFVA
AAGEQLLVQGNQIVDIFALNHPNSGLYSGGDMVLRSPDAVMGDAHYWSGGNFRIEKLDGS
LGDLESPDDPIIRASGDVNFANYIGASLHIFAGGSVTINDVTITGADLTGNAIVEPNVIL
SNGTTQDIDGINQPTLDIRAGTTAFNPIGNIGVPLPAGLTTTATPTSANITIGNIDVTVP
NGLVFLTNQYQPNTTLPGGNIQVTTIDTRSNIDNGGNVIIDSRGNITLPGNGFINTSSSA
NNAGNVTLIANGSFSSTGGDIGSTISSRVGAKGGDINIQAESLFLSNASVVENSVSSGGI
GNAGNVNINVRNSVTLTQTNYGANPTLISSEVGSGAVGNGGKINIRAGSLLIEGTAGVQV
PSEGRGNAGNVFVQVDDSVSLIDGGIIYSPVSTGGQGNAGTIQIFAPNSVTISGVNPDRG
RNGGVSSGLFTSTATRTSGQAGGITVNTGVLRVQNGAVVNASTSNSSDGGTVGINANSLE
LTGGGQILAVTRGSGSAGTVSLNIADTVTISGSDPNFLSRLTRFGRDVVTNEDAASGIYT
DASLGSTGNGGNLDMLTRQLNVSDGGQILTSSFGTGNAGELSITATDSINVVNPNSRIIT
SSFGSTGNGGKLSISTSQLNVSDAAEVATNSFGAGKAGDLSITNADTVTVSNQGLLSTGS
LGSGNGGTLSISTRQLDVINSGLDGGISTIAIGTGNSGNLSIVATESMNVVGGSNVITSS
DKGTGIAGSIDITTNRLSIRDGSRVVSSTIGAGDAGDVTIRATDSVEVVNLSKLSSDTFG
NGNAGDLNIETGKLSIQNAEVSTGTFENSTGRGGNLSINASNVELIGGSIATATRGQGEG
GDIRLQANSLNLSNQGTITSSSEGKGNAGNAGDIFINLSDRLTSNRGIIAATSAQTGGGD
INITADDIRLRDSSVISSSVFDSNGGGGNITIKSTIFLALDDSDILANADAGPGGSITIN
SPGFVANLFARGQAVAVGRNPGDLSRFRNNGQVDISDDFARFAGNNRTDISTASVSNTSG
PATFPNVEQIRAVASLPSDLVDPEDLIDRRCAPSSSTKTSRFTITGRGGLPPNPNDPLMY
QDELVDWVTLENPEETSSSKASNTNSTPSHPQQLVEAQGWVIGEDGKVMLTASASTATPG
NSGLGYPSCEENQATTD
Download sequence
Identical sequences K9WCA9
WP_015181602.1.75295 gi|428309875|ref|YP_007120852.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]