SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428309884|ref|YP_007120861.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309884|ref|YP_007120861.1|
Domain Number 1 Region: 674-974
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 3.92e-55
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000482
Further Details:      
 
Domain Number 2 Region: 438-608
Classification Level Classification E-value
Superfamily GAF domain-like 3.71e-39
Family GAF domain 0.0039
Further Details:      
 
Domain Number 3 Region: 374-421
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000235
Family HAMP domain 0.0052
Further Details:      
 
Domain Number 4 Region: 139-245
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0000282
Family LuxQ-periplasmic domain-like 0.058
Further Details:      
 
Weak hits

Sequence:  gi|428309884|ref|YP_007120861.1|
Domain Number - Region: 91-179
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0031
Family Sensory domain of two-component sensor kinase 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428309884|ref|YP_007120861.1|
Sequence length 984
Comment methyl-accepting chemotaxis protein [Microcoleus sp. PCC 7113]
Sequence
MTGIELPSVASTSSPNLSYSKKHKSLSLKWFENLPVRGKQLTGLFTSEVISIVGLVGVGA
VLIVAAGRTQLVRQAESELAVAQINYDFKINQMESSFRAQSDNAAIITAAIAHAQNQPLT
PELRGQIKQILKNEAQASNIEYATLVGKDRRIIVNANADRTGETFDPNNLVSQVLSNSQP
LQASQIISGSDLSKESPPLAQGLANQDALIRYTITPVKDPKTGSVVGTLVSGDVVNGKLS
MVENTVKAFGGGYSAVYARQPSGKFALATALDQGIAKDVAQAKPNVPLFDPSVLEKAVAA
PNQVVTGRAVAGTQSYTVAAKALSDVNGKPVAVLVRGTEENALNKLLGDSLLLQLAVSAL
TLAVDVGLAVLLGRTIAQPIKRLQQTTQRFARGDRQVRAKALTNDEVGQLAHTFNELADS
IVLNERVLEQQARYQKAEAERSQAFAEFTSRLYKSLDVQDILNTVVNGVRDLLQVERVLV
YSFQENYRNGTVTAESVVSGWMNAIDLVSYDLLETRDIEQFKTGQVVICNDIYDGSNTVV
RFDILQHLQVKATMIAPLFLGNNLLGLLCVQQCSEPRNWQPQEIALFQQAQAQSNLALQQ
AHLIEQLKRARQEAELGRQKAIEFAQVEQARQVAELTSIEQRQQKEELQHQVLTLLQDIE
ASADGDFTVRANVTEGTIGTVADFFNAIIENLRQIVWQVQQTAIQVNSALQVDEQSVEQL
SLTALKQADEISQSLESILAMTSSIQAVAENARQAAAITRIASTAAQTGGKAIDSTVNNI
VNLRERVVETTNKAKVLDESSQEIAKVVTLVQEISLKTNLLAINAGLEASRAGAEGEGFR
VVADQIGKLAKQSVSATKEIEQVLEVIQQNTKGVVEAMEEGRTQVINSTEMILDVRQSLE
EIFEVSHQIDGLVQSISDATVSQAQTSQIVTALMQEIAQISQQTSDSSLQVSSSLRQTVE
VAQYLQQSVGRFKIGSFEDETWER
Download sequence
Identical sequences K9WAP5
WP_015181611.1.75295 gi|428309884|ref|YP_007120861.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]