SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428309935|ref|YP_007120912.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309935|ref|YP_007120912.1|
Domain Number 1 Region: 961-1210
Classification Level Classification E-value
Superfamily EAL domain-like 1.44e-82
Family EAL domain 0.0044
Further Details:      
 
Domain Number 2 Region: 759-928
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.8e-38
Family GGDEF domain 0.00028
Further Details:      
 
Domain Number 3 Region: 489-602
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.35e-24
Family Heme-binding PAS domain 0.02
Further Details:      
 
Domain Number 4 Region: 211-367
Classification Level Classification E-value
Superfamily GAF domain-like 2.62e-22
Family GAF domain 0.032
Further Details:      
 
Domain Number 5 Region: 355-468
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.48e-18
Family PYP-like 0.094
Further Details:      
 
Weak hits

Sequence:  gi|428309935|ref|YP_007120912.1|
Domain Number - Region: 635-680
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00192
Family Heme-binding PAS domain 0.069
Further Details:      
 
Domain Number - Region: 659-750
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0068
Family PYP-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428309935|ref|YP_007120912.1|
Sequence length 1223
Comment PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MIQQPWVFWTPKLSWLQISSHSLIVLFYYSISILVFYFLFQRKALFYAGSWMLFGTFTLT
SGTVELMNGWTVGYLHPWLASLSEAIAVAMLLSTVLLVALLLSKVLAKPDSAHPQASLQN
QLDVNTTHAAASETPAVAVTEESALVAENSMLQQNQTQPLNIDWEQQINEQIAQLQRNHP
QLNGDIPGRVRWLEELGLLQSLSTLISDAPDFHSALCMALRLVCEVTNWDYGEAWLPRPD
DRVLECTPAWYSKTPTLEPFRFSSQKLTLPPNMGLPGRVWTSRRPLWIEDISALTDTSMV
RPQAQVAGLKAGFGVPILMGDRVLAVLTFFITQSRAEDDQLVELVSAVATQLGLVMQRKQ
LEEELRQERDFSKTLIETSSAFFVAVDAQGRILMMNQAFLNAVGYTLVEVLGADYLLTFA
RQCDRKLLYKNFKQLVKSRQPILKENYVLTKDGRELLVEWRGKSIFRHSPAEAGNEEELD
LLFGVGIDITERKQLEQELRHSEERYRAVVEDQTDLICRFIADGTITFVNDAYCRYFGKT
REELLGSNLLQMIPGSYRQKTQKHIASLSLKNPVATREYQILMPDGETHCLQWTDRVIVD
PEAKKRGELHLSGSSQCSSTPGYDPIVEFQSVGRDVTERRRSEHETARLASIALLSPNPI
VETDLAGNVRYLNPEAMRLLPDLQEMGAEHPFLTGVPSMTTVLQRKGSMRRELKIGEIYY
EQVLHYLEEIECFRIYAFDISDRKQAEQQLIHNAFYDQLTGLPNRALFMDRLKQAMRRAR
QSRRSDSRGVPYLFAVLFLNLNRFKLVNDSLGNEVGDQVLQEFAQRLQMCLRATDTVARL
GADEFTILLEGIQDVNDATRVAELIHETLSTPFELNDCSNQNSSEDTASGNREVFMTLSM
GIALNTNHDEQPEDLLRNANLAMYRARSPVALRGTQSQGKAHYEVFDAAMHEIAVERLQI
ETDLRRAIEREEFRVYYQPIVSLSTGSIIGFEALLRWQHPQRGLISPNGFISTAEETGLI
SPIGWWTLREACHQLKQWQEQFPSAKPLTMNVNLSCKQFTQSDLLEQIDTILQEAQPAVG
SLKLEITESVVMENPDWVKDVLLELKKRMIPLCIDDFGTGYSSLSRLHHFPISTLKIDRS
FISRIGALGENSEIVQAIVTLAQTLSMDVVAEGIEVSEQVSPLLALQCEYGQGYFFSKPV
DSEAARALLMAEWEQRKEEVGNG
Download sequence
Identical sequences K9WCH2
gi|428309935|ref|YP_007120912.1| WP_015181662.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]