SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428309977|ref|YP_007120954.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428309977|ref|YP_007120954.1|
Domain Number 1 Region: 2-140
Classification Level Classification E-value
Superfamily CheY-like 2.99e-26
Family CheY-related 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428309977|ref|YP_007120954.1|
Sequence length 148
Comment response regulator with CheY-like receiver domain and winged-helix DNA-binding domain [Microcoleus sp. PCC 7113]
Sequence
MTQTILIVEDNPADILLIQRAFRQADLSHISLQIVRDGDAAVLYLSGEGEYSDRECYPLP
MLMLLDLKLPRRSGHEVLEWIRQQPDLKRLPVIMLTSSRETLDVNQSYDLGVNSYLVKPI
GFTALVEMLRTLNLYWLMLNEPPEFQYS
Download sequence
Identical sequences K9WBD4
WP_015181704.1.75295 gi|428309977|ref|YP_007120954.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]