SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310061|ref|YP_007121038.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310061|ref|YP_007121038.1|
Domain Number 1 Region: 52-222
Classification Level Classification E-value
Superfamily GAF domain-like 2.84e-56
Family GAF domain 0.0000715
Further Details:      
 
Domain Number 2 Region: 1161-1351
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.06e-39
Family Histidine kinase 0.0019
Further Details:      
 
Domain Number 3 Region: 871-1041
Classification Level Classification E-value
Superfamily GAF domain-like 6.11e-33
Family GAF domain 0.00093
Further Details:      
 
Domain Number 4 Region: 503-671
Classification Level Classification E-value
Superfamily GAF domain-like 1.74e-28
Family GAF domain 0.0022
Further Details:      
 
Domain Number 5 Region: 244-367
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.14e-23
Family Heme-binding PAS domain 0.029
Further Details:      
 
Domain Number 6 Region: 365-489
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.54e-23
Family Heme-binding PAS domain 0.02
Further Details:      
 
Domain Number 7 Region: 714-865
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000000000131
Family GAF domain 0.015
Further Details:      
 
Domain Number 8 Region: 1071-1112,1142-1172
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000192
Family Homodimeric domain of signal transducing histidine kinase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428310061|ref|YP_007121038.1|
Sequence length 1355
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MQSCNSDLNHSLAHMTESMSDNTDNEWTLKKKQELISTNLNQANSWSKQPAQQDQWTQLL
AKITLKIRQSLQLEDILQTTVTEVRELLEADRVLIYRLWPDGTGSGVTEAIVPGWSTVLG
QVFEAEVFPQEYHQLYASGRILAIKNVEDAEISPCMVEFLQQFEVKSKLVVPILLKEKLW
GLLVAHQCAHPRQWLRGEIELLQQLADQVSIALSQAQYQEHLEELVAQRTAKLTKTLEQL
QQEINERQRTEKALRESEERWRSLVKNAPDLIFTCDRTGKILYINRTVPGFTLEQAIGSS
VYDYIPDESKPLLKQSFERVFQTGEAVYYETQGSGAYGTTSWYASRVGPIQQEGEVIAAM
VISTDITERKQAEELLHLREQEFRALVEHSPDLIVRFDPQLRHLYVNPAVERSTGIPRQT
FIGKTNQELGMPQELVAGWNKVLLEVLATGQEGMIEFDFPTASGLKSYQTRIIPEFAQDG
TIRFLLGVTHDITPAKQAEKALQQRLLREQALHQLVQSIRNSLDLETIFFTAVAEIGKLL
PVDRALVVQYLPDRKLWLNVADYRASSDLPVALGLEIPDEDNCIAARLKQSQLVLMDHTN
QCEDEINRHFSPTFPGAGLWVPLYLGSQLWGSLSLFVENHAYAWQDSEVQLTLAVAEQLA
IAIQQAELLNQSQIATVKAQEQAEALKHEIKERKRTEETLRAIYKVSTARKLSFEQRLQG
LLALGRRRFGLEIGALGRVKNNVYEVIAAQVAPKSSFPITKGTIWNLEQTYCSVTLGTKE
PIAFASAGTSSWRHLPAYTSRPVEAYLGMSVVVAGQIYGSLSFFSLHAHQHPFTAGDKAL
LKLMAQWVGALLEHQLSEEELRQSEARFRAIAQREALLNQLASQIRRSLDLNTILETAVH
EIQNLLKIDRCFFLWYRAHETQPVWEVVTEARSPAFPSVIGHCVPLSTFGPLTRRVFNKE
ITRVDNARSLTDPAERKFFFSLGYTAMLALPIHTTSGEIGVVSCGHSTGSRPWRQEEVEL
LEAVADQMAIAIDQAELLHQSRTTAAAAQEQATQLKQALNELQQTQAQLVQSEKMSSLGQ
LVAGIAHEINNPVNFIYGNLTYVSEYAEDLLHLIQLYQEYCPRPAPVIETAAANLDLDFM
KEDFPKIVSSMKGGADRIRQIVLSLRNFSRVDEAEMKWVDIHEGIDNSLLILAHRLKAQR
PEESDIQIIKDYNNLPKVQCYAGQLNQVFMNILANAIDAIASRNACEALGQVNPPCSPEL
FKSHPGLIWICTEVIAERNEVMILISDNGPGMTQEVQRRIFDPFFTTKPVGSGTGLGLSI
SYQIVVEKHGGRLECISAPGQGTVFLISLPIRQSS
Download sequence
Identical sequences K9WDQ0
gi|428310061|ref|YP_007121038.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]