SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310115|ref|YP_007121092.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310115|ref|YP_007121092.1|
Domain Number 1 Region: 579-844
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.58e-99
Family WD40-repeat 0.00000895
Further Details:      
 
Domain Number 2 Region: 877-1189
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 3.06e-96
Family Quinoprotein alcohol dehydrogenase-like 0.016
Further Details:      
 
Domain Number 3 Region: 103-374
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.62e-29
Family Nitrogenase iron protein-like 0.073
Further Details:      
 
Weak hits

Sequence:  gi|428310115|ref|YP_007121092.1|
Domain Number - Region: 541-577
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000602
Family Pentapeptide repeats 0.028
Further Details:      
 
Domain Number - Region: 351-440
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0161
Family HxlR-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428310115|ref|YP_007121092.1|
Sequence length 1213
Comment WD40 repeat-containing protein [Microcoleus sp. PCC 7113]
Sequence
MAVQKQRRKRGVVLTSVGFKKLQEARAQAEFGDNGGERYTLEELSDRTQLAPYTVAKVLA
REEGVDKQTLILFFRAFNLELADGDYDRVNSNREQPNQTTILPTRCSWGEAIDVSVFFGR
TDELAKLEYWILQQRCRLIALVGMGGIGKTALSVKLAEQIQNQFEFVIWRSLRNAPPLPE
ILAHWIECLSDGETDLSEQRNQRISQLIDYLRSSRCLLILDNVESILDSGAHVGRYRDGY
EEYGELLRRVGEASHQSCLILTAREKPKEIACLEGGHLPVRSLPLMGLNVVEGQEIFRYQ
NHFNGSESDWNVLIHRYIGNPLALRIVATTIQDLFNNSISEFLEQGTTVFGDIRDLLDQH
FHRLSPLEMQIMYWLALNREPISLTELREDIVAPCSQAKLLEALESLLRRSLIEKATPAF
LAKNQLLFTLQPVVMEYLTEKFIEDSIQEIITYLENHPSSSIRQFKDYAFIKATAKDYVR
ETQIRLILNPMIQQLLYLLGSPSNIQHQLCQLLNQLRGKSPIETGYAAGNALNLMNQLPI
DLRGQDFSHLTVWQAYLCDVDLHQVNFAYSDLSKSVFAENLENVLSVTFSPDAKILATGD
TNGDICLWQVVDGQRLLNCQGHAGGVLCVAFSPDGKTLASASYDHTVRLWDASTGQCLNV
LTGHDLWVWSVVFSPDGKRVASGAVDSTVRLWDITTGQCLHVLHDDSQSVLSVAFSPDGK
RLISGSIDHQVRLWDVATGRCLHVYRGHTRWVWSVAFSPDGKTIASGSQDHTIRMWDVAT
GDCIQVCHGHTNWVWSVAFSPDGQLLASGSTDHTVKLWDTPTGYCLKTLQGHISWIWSVA
FAPQRQGNSPDSYILASSSIDQTVKLWDVATGRCLRTVQGRCSWIRALAWSPDGKILASS
SYNQGVKLWDTTTGQCLKTFQGHSDTLLNAVLSVSFSPKNRILASGSYGQTVKLWDIETG
QCLRTIQGLNGGGWSVAFSPDGQYLATGSDRTIRLWDVDTGQCLKTWTGHADIVFSVAFS
PDGSMLASGSEDTTVRIWHVATGECLMVLQGHISWIQCVAWSPDGQILASGCSDETIKIW
DVQTGECLRGWQEDTHGYGIWSIAFSPNNRTLASVGTDQNVRLWDASTGECLNLLQGHDQ
GLFSVAFSPNGHRLASGSRDDAIKIWDVQTGECLKTLRSHRPYEGMNITRVTGLTEVAIA
NLKALGAVDVANP
Download sequence
Identical sequences K9WD03
gi|428310115|ref|YP_007121092.1| WP_015181838.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]