SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310177|ref|YP_007121154.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310177|ref|YP_007121154.1|
Domain Number 1 Region: 559-724
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.07e-42
Family Histidine kinase 0.00065
Further Details:      
 
Domain Number 2 Region: 356-481
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.63e-24
Family Heme-binding PAS domain 0.042
Further Details:      
 
Domain Number 3 Region: 234-343
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.83e-19
Family Heme-binding PAS domain 0.037
Further Details:      
 
Domain Number 4 Region: 488-571
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 3.14e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0027
Further Details:      
 
Domain Number 5 Region: 109-231
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000541
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428310177|ref|YP_007121154.1|
Sequence length 729
Comment PAS/PAC sensor signal transduction histidine kinase [Microcoleus sp. PCC 7113]
Sequence
MKTVITKRTISTWFGLALCLLSGVTILSYWSLMSQPWMGNGFNPMWLVAIANSCSLVVLG
WLYDRLGLGFTPSPYLEDIPCPSTQPEHDHKSLAEPLDSALQPGHQQSTQSQSMEETLKS
SEQRFRVALQNSPTFVFSQDSELRYTWIYNPNRETQVQKVIGQSDAEIMAPEDAKRLTAI
KQRVLTTGVGTREEVFVTVNGEIRYYDLTVEPLLKSTGDIVGITCAGTDITGIRIREQQL
RAIFEQSLDAITITDNQGIYLEANPAACKLFGLPLSELLGRRIVDFMEPGFDFKSAWRSF
RKQRQLTGTIRLLRLDGTVRNVDYSAKADFLPGRHLSILRDITEREQVEIALRESQQQVE
LALLEERNFISAILETVNALIAVLDAQGRFVRFNRACEQMTDYSLEEVKGKYIWDLFLIP
EEVEPVQSMIQELQLGQFPNESEHYWVARDGSRHLISWFNTVILDTDGSIKHIISIGIDI
TDRKRAEDMRRALEREQALSELRLRFFSMASHEFRTPLSTILLTAQILESSAQGWSQEKR
TRNLQRIVSAAKEMRQMLDDILTINRAETGRIEFAPIPIELNDFCQQMLQEMRAYATPLH
TLAFFNQSEAKWAFMDKKILRYILSNLLSNAIKYSPKGGEINFKILQNQEFILFQIYDQG
IGIPLSDQPHLFEAFHRGANVESIPGSGLGLTVVKKCVELHDGRIMFTSEVGAGTTFTVM
IPIQIANES
Download sequence
Identical sequences K9WBZ1
gi|428310177|ref|YP_007121154.1| WP_015181900.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]