SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310181|ref|YP_007121158.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310181|ref|YP_007121158.1|
Domain Number 1 Region: 4-268
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.74e-57
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Domain Number 2 Region: 1672-1823
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.25e-35
Family Histidine kinase 0.0059
Further Details:      
 
Domain Number 3 Region: 1369-1559
Classification Level Classification E-value
Superfamily GAF domain-like 1e-24
Family GAF domain 0.0061
Further Details:      
 
Domain Number 4 Region: 301-595
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000157
Family Nitrogenase iron protein-like 0.079
Further Details:      
 
Domain Number 5 Region: 1246-1322
Classification Level Classification E-value
Superfamily TPR-like 0.0000569
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 
Weak hits

Sequence:  gi|428310181|ref|YP_007121158.1|
Domain Number - Region: 1582-1622
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000137
Family Homodimeric domain of signal transducing histidine kinase 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428310181|ref|YP_007121158.1|
Sequence length 1826
Comment ATPase [Microcoleus sp. PCC 7113]
Sequence
MITLPGYQIFTKIYENTNSKVYQGIRERDKKAVILKVLKEDYPTPSELTRYKQEYEITRH
LNLEGVVKAYGLETYQRTLVIILEDFGALSLKQWMNGQRAVGKGTLPLQEFLNIATQIAE
ILAAIHSRNIIHKDINPGNIVYNPETGQVKIIDFGISTQLTRENPTLRNPNVLEGTLAYM
SPEQTGRMNRSLDYRTDFYSLGVTFYELLTGKLPFATKDALELVHCHIAKVPISPHEVNS
EIPLAVSNIVMKLMAKTAEERYQSAFGIQVDLELCLTQLESDGEISEFSLAKSDISDKFQ
IPQKLYGREAEVETLLAAFERVAGGTITDTLKAAPTQTKPAGGGGIEMMLIAGYCGIGKS
ALVAEVHKPITEKKGYFISGKFDQFQRNIPYSAIVSAFEELMQQLLTETEAELNHWREKM
LIAVGSNGQIIIDIIPEVELIIGKQQAVPELGATESQNRFNLVFGNFIRAFCTKEHPLVI
FLDDLQWADSATLKLIELMMMDADSQYLFLIGAYRNNEVNPAHPLMMTLEELQKAGVNLN
FITLNPLGLEPISQLIAETLHHDIASVKPLAELVVKKTEGNPFFVNEFLKTLYTENLLTF
NPPQSFLTPPIPLIQRQVQEESLNCLPFPGGSKGGFWEWNIAQIEAQDITDNVVELMIGK
VKKLPEFTQQILQLAACVGADFDLNTLSIITEQSQIKIYSQLTPAVQSGLVIPTSEFNDN
LLIQPYKFLHDRVQQAAYTLIDETQRQSIHLQIGRFLLQNTSPQKLSEEIFKIIDHINVG
IELLTQQKERYEMAKLNLIAGQKAKAATAYGAALEYLNMALKLLSSRSWQNNYNLTLTIH
EEAVEAAYLNGNFFVMDQLAGVVLNKAKTVLEKVKVYDVKIQAAGAQGNFKAAIEIGLQV
LKLLGVILPEEPSQLDIQKGFQENFSLYDGQKIEELINLTDMTKPEPQAAIHILSSISAA
AYIANPELMLLIVLSMVNLSIKYGHTTWSAFSYACQGLILCGVAQDIELGYKFGKLGLTL
VEQLNPKRGKARALEVLGAHVMHWKEHFRTTLPILREGYRSGIETGEFEFAGYCAFFVCD
HSYFIGHELTDLEQKMATYGSAISQIRRENPLNWVAMFRQGVLNLLGRAEHTSRLIGDAY
NEEQWLPLALQTNDRLGIHLLYLNKLILGYLFGEEHQALENAIQAEQYLDGVTAMVVVPI
FYFYDSLVHLNRFAKASTFEQEVILNQINTNQKKMEQWANHAPMNHMHKFYLVEAEKARV
LGQILEAEELYEQAIAGARENEYIQEEALAYELAAKFYLARGRLKIAQLYMKEAHYAYTR
WGATAKIRDLEAKYPQLLPLSSATQSLTSTRTTTSNSTTSSNSASSLDLATLMKASQAIS
GEIVLDKLLASLMKILIENAGAQSGFLILPSTSENGHENWVIQASGSVDEEQKTILQSIG
IDSVEVSTQMPLLSAAIVHYVIRTKENLVLNDAVHAGKFTQDAYILTKKPKSILCIPLLD
RTKLSGILYLENNLTTDAFTEDRVELLKLLSAQVAISIENAQLYTNLQHFNENLEQLVQQ
RTVQLSQALNDLKATQTKLVESEKMASLGGLVAGVAHEINTPIGISITAASLLADKVTEF
FGTYKSGQMKRSQLEKFLDTAMQSSSMVLSNLHRAADLIQSFKQVAVDQCTEEQRTFNLK
QYLSEVLISLRPKLSTTHHQVEIEGDEAIALNTYPGAFSQIITNLVMNSLTHAYSPEDAG
HLVFEFKQQGEQIILTYSDDGKGIPKENLSKIFDPFFTTKRGQGGSGLGLHIVYNLVTQK
LNGTIEGESQVGVGTTFIIKLPMERK
Download sequence
Identical sequences K9WDZ6
WP_015181904.1.75295 gi|428310181|ref|YP_007121158.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]