SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310184|ref|YP_007121161.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310184|ref|YP_007121161.1|
Domain Number 1 Region: 9-126
Classification Level Classification E-value
Superfamily CheW-like 0.0000000000994
Family CheW-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428310184|ref|YP_007121161.1|
Sequence length 148
Comment chemotaxis signal transduction protein [Microcoleus sp. PCC 7113]
Sequence
MQNDPTSDKFIVFRIADCLLALPMNNVLKVINSPSINSGGLRAMGLIQLGRHTIRVLDLY
HQLSPKQPLPSSGNQPFLVITRSPQGELLGISVDEPPNLMELPRDSLRSVPQSERQSGVR
KLISHAAVISQKQATTTIFLLDLKHAGE
Download sequence
Identical sequences K9WBI8
WP_015181907.1.75295 gi|428310184|ref|YP_007121161.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]