SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310186|ref|YP_007121163.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310186|ref|YP_007121163.1|
Domain Number 1 Region: 1790-2090
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 9.42e-62
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000263
Further Details:      
 
Domain Number 2 Region: 838-1008
Classification Level Classification E-value
Superfamily GAF domain-like 5.89e-55
Family GAF domain 0.00044
Further Details:      
 
Domain Number 3 Region: 659-828
Classification Level Classification E-value
Superfamily GAF domain-like 4.36e-54
Family GAF domain 0.00033
Further Details:      
 
Domain Number 4 Region: 1018-1186
Classification Level Classification E-value
Superfamily GAF domain-like 4.36e-54
Family GAF domain 0.00037
Further Details:      
 
Domain Number 5 Region: 1196-1368
Classification Level Classification E-value
Superfamily GAF domain-like 1e-53
Family GAF domain 0.00057
Further Details:      
 
Domain Number 6 Region: 1379-1552
Classification Level Classification E-value
Superfamily GAF domain-like 4.14e-53
Family GAF domain 0.0012
Further Details:      
 
Domain Number 7 Region: 483-647
Classification Level Classification E-value
Superfamily GAF domain-like 4.58e-52
Family GAF domain 0.002
Further Details:      
 
Domain Number 8 Region: 1571-1744
Classification Level Classification E-value
Superfamily GAF domain-like 2.84e-41
Family GAF domain 0.00053
Further Details:      
 
Domain Number 9 Region: 302-464
Classification Level Classification E-value
Superfamily GAF domain-like 5.45e-35
Family GAF domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428310186|ref|YP_007121163.1|
Sequence length 2091
Comment methyl-accepting chemotaxis protein [Microcoleus sp. PCC 7113]
Sequence
MEGTPKRSFLRTLHLASLSTARWLRQLRSSFSSKPLIPEKPLESLPRLPPALAPDHELES
LSRLPPALAPDHELESLSRLPPALPPINWYPERYLSQSPTLVPVPSNGNFSVPLPLRTAL
VRDLLCTSMATFSKNQFLLPGGQPNNGTGNTLIETTPDDPGMPYPSCSDLTGHPDEESTE
EEESSPSHSEADDPSLPSPHPVSAPLCLPEVSVSDGDTSSDFHLDTALPENTDLRDEFTQ
PDLETTKTLTMHTIDPSEHILNPEPQHKLSQSHVNGDWASTGAKGNLPLSLDMEEYLKRE
RQWLLNLAERMRQASTFDTINTLLEITITEVRDHLKLDRVLIYRFQSETHGVVMAESLLT
GYTPSSGAFLPALIFGGNNQKEFYQQQAVTLSPRDSSTTTPYQIQLLKRYQIEASLSLPI
IIDKRVWGLLVVQQCSTSRPWQEAEINLLYQIVTEITLHLQLGEVRNQKQRKIELEKAIG
KVSAKILKNILRSLDVATVFSSATKEIRQQLQCDRVAVYRFLPDWSGEFIAESVGPDWVP
LVGPNIQKIWADTYLQETEGGRYRHEETTAVDNIYTSGVTQCHIELLEQFEAKAYLIAPI
FEGEKLWGLLAAFQNSGARHWEDAEISMLALIGRQFGVALQQAEYLEKLQTRTGQLSKIA
EQERSAARVIDKIRQTTDIDTIFKTTTLEVRKFLDVERVTIYKFRENYFGDFVTESESGG
WPKLVGSGWEDPYLHENRGGRFRNNEPLVVDDVYHAGLTECHVEALEEFGVKSCLVVAIF
QGSKLWGLLSAFQNSGTRHWQESEVKLMMQIADHLGVALQQAEYLRQVKAQTEWQAKEAQ
REQALAKVIDKIRQSLDIDAIFTTTTQEVRKLLNVERVTIYKFREDYFGDFVTESESGGW
PKLVGSGWEDPYLSEHQGGRFRNNEALVVDDVYNGGLTDCHVEALEDFGVKSCLVVAIFQ
GSKLWGLLSAFQNSGSRHWEENEVKLMMQVSGHLGVALQQADYLKQVQAQNEQLAKETQR
ERALARVIDKIRQTLDIKTVFKTAAQEMRILLGVDRVTIYKFRDDYFGDFVFESEFGGWP
TLVGSGWEDSYIQEHQGGRFRNNEPLVVDDVYNGGLSQCHVDVLDDFGIKSCLVVSLFQG
QKLWGLLSAFQHTGPKHWDESEVKLLMQVSAQLGVALQQSEYLTQLEEQSRQISKTAELE
QATNKIVSKIRQSLEIEQIFRTTCTEIRQHLKADRVGVFRFHPDSGFNSGELVSEDVGAG
YTPAMSIEVEDHCFGEKHAENYRKGRIWAVTDIYKANLADCYISTLSQFQVRANLVVPLM
QGTELLGLLCVHQCSGPRHWHKDEMQFAKQIALQCGMALEQVQYLKKVEEQSTQLATMAD
TQKVVAKILTRLSQSQDLDSIYRTTNREARQLLKCDRVAVYRFDPDWSGRFVAESVAKGW
VQLVGPEDIQTVWPDTYLQETQGGRYRNRETFVVDDIYTIGHSECHLEILEQFEVKAYVL
APIFVADKLWGILGAYQNTGPRQWNNAEVTALTQIGQGVGTALQRVNYLEQLEQQSNKYA
KLAERETNFINLLYKTGQRIAEHLQQGTLNPNTLLRATAQELRLLLKADRVAVYRFHPNW
SGEFVIEDVGGSYMRLVGSEWAQVTDSLLKETKGGIYRKNEVSVVNDITDSNSLTFEQQA
LEQWGVKSYAIAPLFNGDQLWGLLAVYQNSELRTWEEGEVKLLVQMATQLGIALQQAESL
DQIQHQSQQLAEAAQREKADKEALQHEVLQLLSAVRPALEGNLTVRAPVTESEVGTVADA
YNNTLQSLRAIVQQVQDSSRKVAQTSQESDVALTSLTEQAQKQFQALEQALDQIQTMVEF
TQGVGNSAQQVEASVQQANQIVRTGDEAMNRTVDGILAIRETVAETSKRIKRLSESSQKV
SRVVNLISNFTTQTQLLALNASIEATRAGEYGRGFVVVADEVRTLARQSAEAATEIEQLV
QEIQKGTAEVSTVMETGIQQVAQGTNLVTDARQNLNAIIEATSRISQLVDGITNATQLQT
QEFQSVTKTMTEVATIANKTSEDSKDISSSFKELLTMAQNLQRHADQFKAN
Download sequence
Identical sequences K9WE01
gi|428310186|ref|YP_007121163.1| WP_015181909.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]