SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310217|ref|YP_007121194.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310217|ref|YP_007121194.1|
Domain Number 1 Region: 707-793,837-909
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.52e-35
Family Histidine kinase 0.012
Further Details:      
 
Domain Number 2 Region: 451-558
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.23e-20
Family Flavin-binding PAS domain 0.046
Further Details:      
 
Domain Number 3 Region: 382-430
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0000000000484
Family HAMP domain 0.0027
Further Details:      
 
Domain Number 4 Region: 619-659,689-719
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000961
Family Homodimeric domain of signal transducing histidine kinase 0.01
Further Details:      
 
Weak hits

Sequence:  gi|428310217|ref|YP_007121194.1|
Domain Number - Region: 198-236
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0345
Family Sensory domain of two-component sensor kinase 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428310217|ref|YP_007121194.1|
Sequence length 919
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MFINSLANRVFKVSEKVPLRILLVVPFVLQICAVVGVTGWISLRSGQKAVQEVTTQLHRE
ITQRLEQHLNSYLKVPQIANHLNADAINLSLLNINDLPTLERYFWTQLQTFDSLGYLALG
KENGDYVEVLRENDGQFLVRVKDAATGTSRHTYTLSPEGKRGKFLHSEPNYDPRLRAFYQ
TAVKVGGPTWTDVYLWIDNRELSTDAVRPIFDRAGTLQGVLDAGSSLSQLGEFLQRLKIA
ETGQTFIIERSGELIATSTPEKPFVIEDGTTKRLPATKSRNSLTRHTARYLTQRFGNLSQ
INSSQQLTFKIDHRRQFLRVTPLREGNNELTDAALLPDWLMVVVVPETDFQERIDQNTRS
TIVLCLAALVFATLLGCLTYHWITQPILRLAAAASALTRGEWNQTVPIERCDELGVLARA
FNQMAQQLQASFVTLSQRQATLAEAQRIAHVGSGELDLTTKCITGSEELLRIFGLELRET
PCHYSEYMQQIHPEDVEAATQAIAQVIQQGQPCEFDCRLQRPDGSIRYISTKGQPTFDRQ
GQVIRYFATVMDITERKLAAQALQQAKLDLEIRVQERTAELSQALEQLQQSEMQLKAQAL
QLQQALADLQQTQAQLIHTEKMSSLGQLVAGIAHEINNPVSFIYGNLSHAKDYSTDLFRV
LQLYQKHYPLPPPIIQQEIEAIELDFLMDDFPQLLSSMQVGAERIREIVRLLRNFARYDE
AQMKEVNIHEGIDSTLMILQSRLCEITGYPAIKVIKEYGDLPLVECYAGQLNQVFMNILT
NAIDAIVSRCKTQASQKKRVRHPQAAEEFLPCIKICTGMLELKSQEDGHPASSLSPRLLI
RISDNGCGMGESVRSRIFDPFFTTKPIGSGTGLGLTTSYQIVVEHHQGRLEVTSLEGQGS
EFAIELPLRQNQGKRGEKA
Download sequence
Identical sequences K9WC25
gi|428310217|ref|YP_007121194.1| WP_015181940.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]