SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310283|ref|YP_007121260.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310283|ref|YP_007121260.1|
Domain Number 1 Region: 57-368
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.28e-31
Family Filamentous hemagglutinin FhaB, secretion domain 0.0072
Further Details:      
 
Domain Number 2 Region: 602-741
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000518
Family iota-carrageenase 0.051
Further Details:      
 
Domain Number 3 Region: 825-969
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000000722
Family Virulence factor P.69 pertactin 0.031
Further Details:      
 
Domain Number 4 Region: 968-1071,1099-1122
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000248
Family Filamentous hemagglutinin FhaB, secretion domain 0.094
Further Details:      
 
Domain Number 5 Region: 1127-1209
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000137
Family Pectate lyase-like 0.086
Further Details:      
 
Weak hits

Sequence:  gi|428310283|ref|YP_007121260.1|
Domain Number - Region: 463-598
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00424
Family Chondroitinase B 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428310283|ref|YP_007121260.1|
Sequence length 1433
Comment filamentous hemagglutinin family domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MVALISGMLWMVTYFPGDFGLGLIRVLKVGGVITLRGCCAISFAGAPWAIAFAGNPALAQ
ITPDTMLGTESSVVTPNINIRGLPGDRIDGGAVRGANLFHSFQEFNVGEGQRVYFANPTG
IENILSRITGNNLSNILGTLGVDGGANLFLLNPNGIIFGAGAKLDISGSFLASTANSVVF
NNGYQFSATNPEAPPLLTVSVPLGVQYGSNQPRATITNSGILAVGQNFTLNAGNLDLQGL
VQAGKDLTLQAQDTVKIRDSAINPFIAAAGNQLLVQGNETVDIFALNHANSGFFSSGDMV
LRSPNSVMGDAHYTTGGNFRIERLDGSLGNLWSPGDPVIRATGNVSFTNYTGASLHIFAG
GSVNITGRVTITGIDATNFINETVTLSDQTTELSVNGSTRPTLDIRAGTLAVGNPVNVCV
GCPLFQPTSLTFLNTPLTADITINEIVINRPDGLVFLTNQYQPNSALAGNIQVTGIFADD
SNGSFIGKGSDVVIDSRGNITLPEDGRIQTNSGTGNAGNVTLFANGSFFMNPGSQIQAVT
FGQGNSGNVTIKVGDAVINSGIGTVIYTNVGSDTGANAGDINIQAGSLSLIDGAQLQAIG
GQGNAGNVIINVRDDVLISGADSSGEYNSSIYTSIGEGATGNGGNIEIEAGTLTLTDYGF
LDAGAFSVDGGVSSQGQSQAGNIILNVRDTITVAGFNAISGYPSGMSVGTYAGASGQAGR
ITINTDKLRVADGAYLSASTYNSSNGGEITVNANIVELTGGGQILALPYAQGNGGNVTLN
VSDRLTISGYDPTFQSRLIEFGSGVVINQGNVSGVFTGYGLGVLPTFLNIPVESTGNAGN
ISIIGPREVNIDQGELFTGAFNTGNAGTLSITQTGSVRLTNLASMSTSTFGTGNAGTLLI
ETGNLSVQNQSFIISATVGDGDAGDLTIRANDSVEVNSGSRITSQTSGSGNAADLTVETR
RLSLRNGEISSGAGTRITTDGDFLIFSQSNGRSGNLTIKALESVDIGGEPGTPIGGLFTA
TFGYGQGGDLSVETGRLTIQDGGRIEAGTFGNGLGGTVRINALESIELIGTSADGTFASG
VSAYSRPPLDFDANLWQGNANSGGVNLTTNQLIIRDGAEVTTAVEGASQTGNAGDIQVQA
NSLSLTNGGRITSRSDGVSNAGNINVNVTGNLRSSGGTISATSTQLGGGNINIAADDIRL
DGNSLISTSVKESTGGGGNITINSTVFLAIEDSDILANAADGRGGDIFINSEAFLADIFS
RRLAEPVGRNPGDFARFRNNDRVDISADSKAGQSGTVTYPDIEQIRGVPALPSNLVDAEG
LIDRRCTPNNDARKSSFTITGRGGLPPSPSDPLMNDEVWVDWISLEEREENGNAAATETH
STSSNPKSLVEAQGWIINEKGQVVLTAQAPTVTPNRPQLELPPCEENEAAFDQ
Download sequence
Identical sequences K9WDL9
gi|428310283|ref|YP_007121260.1| WP_015182006.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]