SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310298|ref|YP_007121275.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310298|ref|YP_007121275.1|
Domain Number 1 Region: 1296-1395,1460-1534
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.19e-44
Family Histidine kinase 0.00059
Further Details:      
 
Domain Number 2 Region: 167-293
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.14e-24
Family Heme-binding PAS domain 0.013
Further Details:      
 
Domain Number 3 Region: 421-549
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.74e-23
Family Heme-binding PAS domain 0.038
Further Details:      
 
Domain Number 4 Region: 589-717
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.9e-23
Family Heme-binding PAS domain 0.052
Further Details:      
 
Domain Number 5 Region: 60-172
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.06e-22
Family Heme-binding PAS domain 0.028
Further Details:      
 
Domain Number 6 Region: 788-937
Classification Level Classification E-value
Superfamily GAF domain-like 5.89e-22
Family GAF domain 0.022
Further Details:      
 
Domain Number 7 Region: 1102-1225
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.27e-20
Family Flavin-binding PAS domain 0.064
Further Details:      
 
Domain Number 8 Region: 294-422
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.41e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.047
Further Details:      
 
Domain Number 9 Region: 1228-1308
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 5.89e-20
Family Homodimeric domain of signal transducing histidine kinase 0.0011
Further Details:      
 
Domain Number 10 Region: 966-1049
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000324
Family Heme-binding PAS domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428310298|ref|YP_007121275.1|
Sequence length 1550
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MTSELGLSLLILLAFATSATQSSVIGLLGFSLMLGIVWIFYFLNRQIHKRQQTEADFQLL
YNHAPCGYYSVNQDGVLIAINDTQLRWLGYSREEVIGSLQLTDFMVSEDAESWAKIFARI
QSQGEVKNVEIQMIRKDGTSLPVLLSATAIRNAVGQFVGACGTILDITQHKQTQDALRKS
EERFRLAIDHIPDGFVIYDQQRRLQFVNAEGLRRSGHSQEELLGHTDEEIYPPEITSQYL
PTLLRAVETRRIQTSECTLTLPTVGTFTVVVTYVPLLNEQGEISSILGITHDLSDRKREE
EALRESEARVRLALEATQIGTWDWDILTNQMTWSSGDQRVFGLTNGTFEATYEAFETCLP
PEERDSLLGAVNRSRRTRREFHHEFRLMWPDGSLHWVEGKGKFFYNQEGQAIRMVGTLVD
ISERKQVEAQLQQSEEKFRQLTENINKVFWMTTADFSEMLYVSPAYEQIWGRSCESLYAN
PKSFAEAMHPEDRQQALARFEDNTTQELDIEYRIVQPDGSWRWIRDRCFPIRNHAGEVYR
RAGIAQDITDQKQAETSLRQTNEDLERRVTLRTTELQKANQLLQRELLEREQMEQALLLA
YQHLQFHVENTPLAVIEWDCEYRLINWSKQAERIFGWTSEEVIGKHPQEWKFIHEQDSER
VNKVMEQLATGSQPRNLSDNRNYTKDGRVIDCDWYNSALCDASGKLVSILSLVQDVTERK
QAEAALREAYDQLEIRVQERTRELFKANKELKSENSERKRVEAELNTRARQQAAVAELGQ
QALAGKPLDPLIHQAVALVAQILEVEYCKVLELLPDGKAVLLRAGVGWQEGLVGEATVSI
DLDSQAGYTLLSREPVIVEDLGKEVRFSGPCLLHQHGIKSGISVIIPGQNRPYGVLGAHT
TQYRKFTKDDIHFLQATANVLATAINRQHVEEALRQAHNELEIRVQERTTDLEKANAELQ
QKILELQQAQEERATLIAILEATPDIVATASVDEQIYYLNSAARKVFGIGEQEDFANFTL
TDAHPDWAYELIRHEGIPGAIRDGAWVGETAFLSHSRVGGSSPDGSSKDSHDQGIEIPVS
QVIIAHKSPDGYVKMLSMVARDITQQKKIAATLCEAERRWRSLLENVRLVVVGLDNQGKV
EYANPCFLELVEYSKAEVIGSDWFETFLPQHQKKRQQNNFVEFLEQEFYTHNQTIVLTKS
GEERVIAWNTTLLQDLQGYVVGTLSIGEDITERQVIERMKDEFISVVSHELRTPLTSIHG
ALNLLSSGLVDTHSEKGRRVIDIAAQSAERLVRLVNDILELERLESGKISLLKQTCDVAE
LMIKATEMIQVMANRAGVTLSVSANTISPEASAKALALYADPDRIIQVLTNLLGNAIKFS
PRGSTVWLTVELQEPEERENNSMLLDPALQLSHQVTQTPTLVNGRTKLRQPSPVGENSLF
ILGQTDPSLADLPPHRLTSTVLFKVKDQGRGIPADKLETIFERFHQVDASDSRKKGGTGL
GLAICRSIVQQHGGKIWVESTLGEGSTFYFTLPERNTEEGKDDHKENLSD
Download sequence
Identical sequences K9WDN3
gi|428310298|ref|YP_007121275.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]