SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310340|ref|YP_007121317.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428310340|ref|YP_007121317.1|
Domain Number - Region: 3-81
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0334
Family ABC transporter transmembrane region 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428310340|ref|YP_007121317.1|
Sequence length 111
Comment hypothetical protein Mic7113_2094 [Microcoleus sp. PCC 7113]
Sequence
MPIVDLLLVITLVILAGVFLRVGPLNRQQQLETAFNRQQLDDAFYQLLEEQSSCISLIQL
TAASRVDVEQVRKYLDRQVKMFGAVPEVDADGDTFYRFPKIQGRPRADKSA
Download sequence
Identical sequences K9WDM7
WP_015182063.1.75295 gi|428310340|ref|YP_007121317.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]