SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310393|ref|YP_007121370.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310393|ref|YP_007121370.1|
Domain Number 1 Region: 391-573
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.37e-70
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000243
Further Details:      
 
Weak hits

Sequence:  gi|428310393|ref|YP_007121370.1|
Domain Number - Region: 313-361
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0017
Family HAMP domain 0.014
Further Details:      
 
Domain Number - Region: 44-254
Classification Level Classification E-value
Superfamily Sensory domain-like 0.0102
Family LuxQ-periplasmic domain-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428310393|ref|YP_007121370.1|
Sequence length 581
Comment periplasmic ligand-binding sensor domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MNLRQKTLLLIGLTLAGLIGVLYASLSTIFGASFAELEERNVRQNVRRVQEAFFDEVETL
NTTAADYAKWDDTYAFINQLNQDFVQANFLDENFVRLRLNMVLLFNNQGKQVVGKGFNLE
QKKETPISDSLQKYLTPNSLLLKHSNPGSNITGIVLLPEGFLMIASHPILNSQGTGSIRG
SLIMGSYLNDKRIEELAKRTQLSLRVYRVNDTQLPPDFQAARSALLDSSPKTQASQLNNQ
QIPIIIRPLSDEAIAGYTLLRDINKKPALLVRAEMPREIYQQGQVSLRYLIFSLLGVGII
FSVVALFLLEKMVLSRLANLSANVEQIGTSTDLSLRVFVTGKDELTTLGNTINSMLNALE
SSTQKVVAERERAERLLLNILPPSIAQRLGHNQDTIADSFEEATVLFADIVNFTNLSSHI
SPTELVSMLNEIFSRFDRLLERYGLEKIKTIGDSYMVVGGLPLIRPDHAEAVAEFALDMQ
QQIQEFNAERGQSFSMRIGINTGPVVAGVIGLKKFIYDLWGDTVNIASRMESHGIPGAIQ
VSSATYERLKDKYLFEERGTIDVKGKGEMTTYLLKNRIGHN
Download sequence
Identical sequences K9WDX4
gi|428310393|ref|YP_007121370.1| WP_015182116.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]