SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310395|ref|YP_007121372.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310395|ref|YP_007121372.1|
Domain Number 1 Region: 756-941
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.1e-44
Family Histidine kinase 0.00044
Further Details:      
 
Domain Number 2 Region: 1131-1251
Classification Level Classification E-value
Superfamily CheY-like 3.84e-37
Family CheY-related 0.0051
Further Details:      
 
Domain Number 3 Region: 267-395
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.79e-31
Family Heme-binding PAS domain 0.022
Further Details:      
 
Domain Number 4 Region: 433-562
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.92e-23
Family Flavin-binding PAS domain 0.076
Further Details:      
 
Domain Number 5 Region: 1228-1241,1278-1378
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 1.7e-22
Family Phosphorelay protein-like 0.054
Further Details:      
 
Domain Number 6 Region: 688-768
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.16e-22
Family Homodimeric domain of signal transducing histidine kinase 0.0013
Further Details:      
 
Domain Number 7 Region: 560-681
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.09e-20
Family Flavin-binding PAS domain 0.053
Further Details:      
 
Domain Number 8 Region: 138-268
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.09e-19
Family Heme-binding PAS domain 0.029
Further Details:      
 
Domain Number 9 Region: 1001-1106
Classification Level Classification E-value
Superfamily CheY-like 0.000000000000683
Family CheY-related 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428310395|ref|YP_007121372.1|
Sequence length 1392
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MLALLANLLLERFIPHGHCYLWKPGLVGLHLVSDVLIALAYYSIPLTLLHFVRKRHDLPF
SWIFQLFGAFIIACGTTHIMEVWTLWHPHYWLSGLIKAMTAVVSVSTAVLLVPLIPKALA
LPSPAQLEAANRHLETEIREHAATTTQLKQALQRLTFHVENSPLAVIELNHDFRVQRWSK
QAEKLFGWQAEEVLNHCLDEGQFVFEEDLPQVQQDMSHLLNGNVPHIVGQNRNYTKDGSV
IYCQWYNSALWDCSGKLVSILSLALDVTERTRAEQALKESETRYRTLVETSPDAISVCEL
NGKLLFCNRQVALLHGYESETEILGRFACELIAPEKRSIAALCLEKVLQHGSIRDVEYTM
IRKDGSRFPAEVSASLIRDAQGQPQAIIGLVRDITDRKFAEDSLKKGKEDLEVQVEQRTA
QLRLVNDHLLVEIQERALAEEALRKSEARLNQALCAAQMGAWDWDMMSDRMTWSEGTETL
FGLMPGALAGSYDACLDYLHPDDRPTVLQALRRTVETGTDYDVEARLIDPNGSTRWVASK
GALIRNSNGTAVRMTGTLMDITKRKQIELALERERQQLRQIIACAPIAMAMFDTQMRYLA
YSQTWITEQGLERQSILGCSHYDIFPDIPECWRSEHQRALQGEVISVSEDVWKRSDGTKV
YLRWAIHPWYLPEGEVGGIVIATDRINELVEAREAALEAARLKSQFLANMSHEIRTPMNG
VLGMAGLLLQTPLTPQQLEYASTIRSSAEHLLTVINDILDFSKLEAGEMQLESIDFELDS
CIESVVDVLAAQAHEKGLELAMWISSDVPKMLKGDPNRLRQILLNLVGNAVKFTDVGQVL
VKVSVSRERGTQTDISETQLPITHYPFPSYLRFEVTDTGIGISAKDQEKLFQSFSQVDAS
TTRQYGGTGLGLVICKQLVELMGGEIGVESALNQGSKFWFTASFDSPTVGEAAACPLVLH
KLKLLVVSAQTTTRQALCAALHRSIRLNDSAVPAGWLSDSWEMQVDEAVDTLTTLNALRL
SVAQGNPYHLAILDLQLPKPQGAILVPMIRCDPTLAQTKLIVMTTSDRLDTVQELEGMDI
SGYLIKPVRASRLLDCLVSAFAPQEPENQSRVSCEPKEATAQNPKPAKSALKILLVEDHE
VNQMVTLNQLAMLGFEADCVGNGEEAIAQLTQQNYDLVLMDCQMPILDGYDTTQEIRRRE
GSERHTTIIALTAHALPNDRQKCIDAGMDDYLSKPIAQEALGAMIERWTKHTVKPTVADT
NSEITHNPQLSTLSLDEIPLDLERLKAISRGKVTFQQQLVQAFIKNAQPGLEQIRLAIPV
KDFEIIMQQAHRLKGASANVGVRLMPEVAAQLEQQARKENLTGATEKLEALESQLDRVKA
FVEKGWMESAMG
Download sequence
Identical sequences K9WDT8
gi|428310395|ref|YP_007121372.1| WP_015182118.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]