SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310447|ref|YP_007121424.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310447|ref|YP_007121424.1|
Domain Number 1 Region: 342-506
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.13e-38
Family Histidine kinase 0.0015
Further Details:      
 
Domain Number 2 Region: 531-654
Classification Level Classification E-value
Superfamily CheY-like 1.85e-34
Family CheY-related 0.0025
Further Details:      
 
Domain Number 3 Region: 272-354
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 3.14e-22
Family Homodimeric domain of signal transducing histidine kinase 0.0011
Further Details:      
 
Domain Number 4 Region: 169-275
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.44e-18
Family Flavin-binding PAS domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428310447|ref|YP_007121424.1|
Sequence length 779
Comment PAS/PAC sensor hybrid histidine kinase [Microcoleus sp. PCC 7113]
Sequence
MLEVLKNLFTSRAFIPHGHCYLWKPELVWLHVMGDALIAIAYYSIPIALVYFVRKRVDLP
YPQIFLLFGAFIISCGTTHVMEIWTLWHPTYWLSGLIKAITAVISLYTAMELVPLVNQAL
ALPSPAQLEAANRELEREIGERKRTEARLELQSTIARNMAEGVCLVRAADSAIVYANPKF
ENMFGYGSGELNGRPVEVLNYASDEQSAKQVASEIMHQLNQYGEATYEVHNVKKDGTPFW
CRSHTSRFEHPEYGTVYVAVHEDITESKQAEQTLHKAKEAAEAANRAKSEFLANMSHEFR
TPLNGILGYAYILKQEKVLTSKQQNGLNTIQQCGEHLLTLINDILNLSKIEARKMEIYLN
DFHFPLFLNNLAEIFRIRAEQKNISFRYTPLSLLPSLVRGDEQKLRQILINLLGNAVKFT
ETGGVVFKVGYHEGKIRFQVEDTGIGIASEKLTEIFLPFHQVENSRHLVEGTGLGLTISK
KLAKLMGSTLEVKSQLGSGSVFWLDLDLPEVLESTEIAKRQERSIVGFKGEKRKILVVDD
KRENRLVLVNLLEPLGFEIVEATDGRDCLNKALEFKPDAILMDLVMPVVDGFEATRQLRK
STELKNIVIIATSASVFNYSQDKSREAGCDDFIPKPVQAKHLLERLGVHLGLEWVYGDWG
LEQAAAGVADRDSEGVTEKSKPGAVKSQKSETVKSNAQTNNPKSKIQNLKLIAPPPEDIA
VLLDLAMRGNIRGIDEQARRLEQLDEKFVSFASKLRQLAQDFQVRQIREFLKPYTLDHE
Download sequence
Identical sequences K9WCQ2
WP_015182170.1.75295 gi|428310447|ref|YP_007121424.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]