SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310448|ref|YP_007121425.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310448|ref|YP_007121425.1|
Domain Number 1 Region: 475-656
Classification Level Classification E-value
Superfamily Nucleotide cyclase 5.02e-66
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000161
Further Details:      
 
Domain Number 2 Region: 157-328
Classification Level Classification E-value
Superfamily GAF domain-like 6.32e-65
Family GAF domain 0.0000995
Further Details:      
 
Domain Number 3 Region: 8-143
Classification Level Classification E-value
Superfamily CheY-like 2.85e-39
Family CheY-related 0.00034
Further Details:      
 
Domain Number 4 Region: 337-450
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.09e-18
Family Heme-binding PAS domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428310448|ref|YP_007121425.1|
Sequence length 671
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MSVKNPADGVLLIVDDTPTNLKMLCDFLTNSGFEVLVAVDGESAIEQTVYAQPNLILLDV
LMPGIDGFETCSRLKANPSTQAIPVIFMTALGETVDKVRGFQVGAVDYVTKPLQPEEVLA
RITNHLTIQNLQNQLQEQNLRLQQEVKERQQAEDLVRQQAQREQLLGEMQGRIRQSLDLE
EILSTTVSEVRQFLQTDRVLIYRFFDDWSGVVAVESVSTDELSILNTTISDPCFGEAYVE
RYQQGRIMVIEDIYTAGMTPCHVDFLASIQVRANLVVPILQKERLWGLLVAHHCYEPRQW
QQWEVDFLEALSTQIAIAIQQGQLHQRLYSIVENAIEGIFQTTPSGRFISGNPALARIFG
YSSPEELIRSIQDIGRQIYVDSNRRDEFIAAIQTDNAVFDFESQIYRKDGSVIWVSENTR
AVRDSKGALLYYEGAVSDITVRKVAQESLRFQQEQAEQLLLNILPESIAQQLKRYPSTIA
DNFEAVSVLFADIVGFTEFSARTSPTELVIVLNLIFSKFDQLAERHGLEKIKTIGDAYMV
VAGLPTPRPDHAIAIAEMALDMQSEMVRVGEQTGEAFKLRIGINSGPVIAGVIGIKKFFY
DLWGDTVNVASRMESQGVDGAIQVTAATYELLRDKYLFEERGVISVKGKGDMTTYLLTGR
SFDDSLLSCNK
Download sequence
Identical sequences K9WE29
WP_015182171.1.75295 gi|428310448|ref|YP_007121425.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]