SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310496|ref|YP_007121473.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310496|ref|YP_007121473.1|
Domain Number 1 Region: 21-315
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.76e-34
Family Filamentous hemagglutinin FhaB, secretion domain 0.011
Further Details:      
 
Domain Number 2 Region: 786-940
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000377
Family iota-carrageenase 0.067
Further Details:      
 
Domain Number 3 Region: 673-769
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000408
Family Filamentous hemagglutinin FhaB, secretion domain 0.084
Further Details:      
 
Weak hits

Sequence:  gi|428310496|ref|YP_007121473.1|
Domain Number - Region: 1036-1115
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000248
Family Filamentous hemagglutinin FhaB, secretion domain 0.083
Further Details:      
 
Domain Number - Region: 574-655
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000691
Family iota-carrageenase 0.063
Further Details:      
 
Domain Number - Region: 970-1036
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0942
Family Filamentous hemagglutinin FhaB, secretion domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428310496|ref|YP_007121473.1|
Sequence length 1382
Comment filamentous hemagglutinin family domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MKRCINPYWIAAGISLCYLATTTPVVAQITSDGTLPTNVTRSGNIWEITGGTQAGGNLFH
SFSQFSVPTGNAAYFNNAPLIENIFSRVTGSSASEIDGLIRTNGTANLFLLNPNGILFGS
NARLDIGGSFTASTSDRIVFADGTQFKATDTASQPLLTISTPLGVQYGTQPSGTINNAGN
LAVKSNANITLFGTTVTNTGQLVAPGGTVQVLGDRIALLDNALIDVSAVGGGGTVLIGGD
YQGKGTVPNASRSFVSKDVTINADALDNGNGGKVIIWSDESTRFYGNIRVRGGKDGGNGG
FVEVSGGQFLDFQGNVNTSAPKGSFGTLLLDPTDIEIVATGGNTTSTNLLFTDPPFPLAQ
IDASVINNALANVVLQATNNITFSTGINIAAPGVGLTAQAGNNITVALPVGNSFETKGGD
MRFIAGNNIVVNTFVSNWISPHGGNIQLIAGAGNGATGSITVDGNLLSFPGNTGNISLAA
RGDISITGRSQIRSNLGDISFNAGGNLFITGISSVDSTRDLFITAAGTILIDNSKVSADR
VSPNSIGGNVNVDAARLRLLNGGQLTADGIFDGNGGIVTIRVPEIEMDSTGIYGNSQISA
SAIRSLGSIPRGNAGKIEIQTGRLTARNGAQIIAATYGSGNAGEVTVRANEIELIGVAFG
DKEASGFFANNQPGSTGGNGRIAINTGRLLARDGAGVFVASFNNQTSGEIRIQASDIALI
GNAPSYGCYGSYGCGGLLARALEGTGNAGAIAIDTNRLLVQDGALIDVRAATGNGGNLNI
RATDSMIVSDRGIVSAVSTGIGAGGNIAINTKNLTVQNNSIVGTGSNNQDNAGSITVRNS
ESVTVSNRSVISSLFYGSGAGANLDIETGNLTISDGSGVLTSSAGQGNAGNLNVRAANSV
NVINNGILSTGTLGTGAGGNLAIETKNLNILTSGKVFTSSLDASTFDFSILDPNIYSPAS
VELIRNSVNAAAQGNFTQGNSGNLTVTATDSVNVATNGLLSTQAYGKASAGNLAVTTGQL
TLQDAGTISTTSFGEGFGGNIQLQANSLSLNNDGRISSRSQGANRAGNISINVRDNLQSS
RGDILATSVQSGGGDININARDVRLRNSSLISSSVFNSTGGGGNITINSETFLALEDSDI
LANADAGPGGNIRIISPAFLVDLFENNRAVAVGRNPGDLSRFRGNSRVDISDNFGRLPNN
QSDIISNAFSSLFDNDRTDISAASQSGSSGTVTIPPIEPFRRLAPLPAGLVDASDQINQN
CSPRRAGDRAQNRFIITGRGGLPPSPNDVLQGDSVTTDWVTLDSQEEQFKDTTSGDRTTE
DSARLTYPPTPVTIAAPTKHELVEAQGWVYGSKGEVILTASASTVTHRSPFITPLSCEDI
KN
Download sequence
Identical sequences K9WEZ5
gi|428310496|ref|YP_007121473.1| WP_015182219.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]