SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310514|ref|YP_007121491.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310514|ref|YP_007121491.1|
Domain Number 1 Region: 374-538
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.7e-38
Family Histidine kinase 0.00071
Further Details:      
 
Domain Number 2 Region: 9-145
Classification Level Classification E-value
Superfamily CheY-like 7.83e-34
Family CheY-related 0.0021
Further Details:      
 
Domain Number 3 Region: 128-256
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.22e-23
Family Heme-binding PAS domain 0.058
Further Details:      
 
Domain Number 4 Region: 300-386
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 3.34e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428310514|ref|YP_007121491.1|
Sequence length 538
Comment PAS/PAC sensor hybrid histidine kinase [Microcoleus sp. PCC 7113]
Sequence
MIAPKIVKAKILIVEDENIVAFNIQNRLEGLGYNVTAVISSGEAALQNVEQNRPDLVLMD
IKLKGPIDGIQAAEQIHRQFKIPVVYLTAYADEETLNRAKITEPYGYILKPFEARDLVTT
IEMALYKHQIEQQLREREQWLATTLKSIGDAVITTDSQGLVTFMNPVAEALTRWNSEEVL
GYDLTQIFHAINEKTREVIENPIKLVLQEGVTVGLENHTLLITKDGSEIPIDDSAAPIKN
EAGNILGAVLVFHDITEQQQIQSVLEKTNEELEVRVAESIAQLKETNEQLRQEIARRQRL
EQELRLALEKERELNELKSRIIATVSHEYRTPLTTILSSADILENYDSRLTLDKKKKHFQ
RIQSSIKYLTKLVEDMLIVNQAETGNLEFSPTFLNVEQIACEIVNECQVNPANPHRILFE
CQGSCTNVFLDEKLLKLILRNLLSNAIKFSPDRNPIRLELSCEPSQVVLRLSDQGIGILP
TEKPWLFNPFFRGSNIGVTPGVGLGLVMVKECVDLHGGEILVESEVGQGTTFTVTLPM
Download sequence
Identical sequences K9WCJ1
WP_015182236.1.75295 gi|428310514|ref|YP_007121491.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]