SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310535|ref|YP_007121512.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310535|ref|YP_007121512.1|
Domain Number 1 Region: 24-218
Classification Level Classification E-value
Superfamily GAF domain-like 3.93e-27
Family GAF domain 0.00046
Further Details:      
 
Domain Number 2 Region: 225-322
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.0000000000628
Family HD domain 0.031
Further Details:      
 
Domain Number 3 Region: 437-547
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.00000000157
Family HD domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428310535|ref|YP_007121512.1|
Sequence length 566
Comment HD-GYP domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MTASYSPILTLESQELLQEASAERVELIEQLLAIGTALSSTNNLDELLHLILFKSREITC
SDAGSVYLINRQEESPTLLFKVAQNDSIPNNPFQEFAMPLTRKSLAGYVALTGEILNLPD
AYNLPPDVPYQLDRSFDTTMPYRTCSVLVLPMQDQDGEIIGVLQLINRKVKPDLVITTEN
SMVVTQPYSQWEERIVRSLASQAAISIERNYLQKSIENLFEGFVKASVQIIEARDPTTSG
HSERVAELTVRLSEEASAITSGPLRLIQFGDRQIQEIRYAALLHDFGKVGIPEAILGKRK
KLYPDQLEIIRHRFALARRTLEMECAQNKFKYLLEHPSHQHRDDTSNTGCSHCQKLEQLE
SQLTQTIEALEYYWEFIRELNEPDVVIRRDFQAFSEETSAQLAALTKYTYRDIDGETKPL
ITEAEMTQLLVPRGNLTNKERLGIEEHVTHTYHFLRRIPWTKHLKEVPTIAYGHHEKLDG
SGYPQGLKQEEIPIQTQMLTVADIYDALTASDRPYKRRLPLDTALKILRQEAAKNKINSD
LVELFEQKQVFTVVGHTLPVDAHSIA
Download sequence
Identical sequences K9WE94
gi|428310535|ref|YP_007121512.1| WP_015182257.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]