SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310633|ref|YP_007121610.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310633|ref|YP_007121610.1|
Domain Number 1 Region: 276-571
Classification Level Classification E-value
Superfamily TPR-like 2.66e-58
Family Tetratricopeptide repeat (TPR) 0.0018
Further Details:      
 
Domain Number 2 Region: 198-310
Classification Level Classification E-value
Superfamily TPR-like 9.21e-35
Family Tetratricopeptide repeat (TPR) 0.0014
Further Details:      
 
Domain Number 3 Region: 6-107
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000997
Family Protein kinases, catalytic subunit 0.016
Further Details:      
 
Weak hits

Sequence:  gi|428310633|ref|YP_007121610.1|
Domain Number - Region: 157-167
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00445
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428310633|ref|YP_007121610.1|
Sequence length 595
Comment hypothetical protein Mic7113_2401 [Microcoleus sp. PCC 7113]
Sequence
MINQVLNNRYRIVRVLGSGTSGLIYLAADIHHPDFPVCVVRQLKLPKKNSLAFTRLQFLI
ERKPDVLDRLAQNHPSSDILDYFVEDQKFYLVEEYVPGHPLNSQTESSSLQSEDQGVVRL
QEMFKMLGSTNTPTPTRSPIPTSPPEAHNKGIDSVQPPPPPPPPPHPQKPRFRKLLWLIL
AAGAFLGLVAGFLVLLQSQNQTNAKSYYNQGVEKLKKEDRRGAIQDFDQAIRLNPNNPLA
YGNRGNAHYDLGDYKAAIEDYSQMIRLEPNKAGAYYNRGLARYDLQDWQGAIEDFDQLIR
LQPNDAEAYYKRGITYFELKNYRAAIEDLNQVIRLNPNEAKAYVSRGLARSEAGDQREAM
EDYTKALELEPKNAKAYYSRGRARFLLGDYGGAVEDYTQAIELEPKNAAAYTNRCSARLN
LSAHQDAIVDCTQAIALNPNKDEPYNNRCIAYFNLKDYQNALQDCSQAIRFNPNNDTAYS
NRGDIRRNLGDKQGALEDYTQAIRLNSNNSIAYSNRADARRDLGDQQGAIADYTDAIRLN
PKNAFAYYGRGLTHLAVGNKSEAITDFQEASRLFLNNGRIGGYNDAQFQLKKLQG
Download sequence
Identical sequences K9WEL6
gi|428310633|ref|YP_007121610.1| WP_015182353.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]