SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310639|ref|YP_007121616.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310639|ref|YP_007121616.1|
Domain Number 1 Region: 192-364
Classification Level Classification E-value
Superfamily GAF domain-like 7.63e-61
Family GAF domain 0.00012
Further Details:      
 
Domain Number 2 Region: 378-572
Classification Level Classification E-value
Superfamily GAF domain-like 3.27e-60
Family GAF domain 0.00013
Further Details:      
 
Domain Number 3 Region: 863-1040
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.83e-41
Family Histidine kinase 0.0035
Further Details:      
 
Domain Number 4 Region: 572-740
Classification Level Classification E-value
Superfamily GAF domain-like 2.09e-25
Family GAF domain 0.0051
Further Details:      
 
Domain Number 5 Region: 54-165
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000548
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.07
Further Details:      
 
Domain Number 6 Region: 771-812,842-870
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000373
Family Homodimeric domain of signal transducing histidine kinase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428310639|ref|YP_007121616.1|
Sequence length 1047
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MNVDHLSKWHESPQNHADLRPIQPMTSTQKSDQTEDFQILNLKRVDLEGILTVYDSLPCI
GFAINSAKIMLAVSQFAADYLGYEVIELAQQPIGDIFYGQDEAICQAQLTAIQQPPHQLT
QWETRLVRKNGSVMWVRAKASLVPNTETDPIITLICEDITEYKQAQEIRRQSQMLCKASL
EESCQHSEEALRQQFLWEQLLGAIAQRIHQSLNLDEILNTTVDEVRQVLACDRVIIFRLH
PDGSGVIVVESVDSGWRPISGISINDHHFAQAYIKLYKQGRVQAVEDIYTADLTPCHRDL
LAQLQVRANLVVPIVHEEQLWGLLVAQQCSKPRMWKSLEIDLLSSLATQAAIAIQQSELY
QQAQTEIAQRQQAEASLQQQFQRERLVSAISGRIRQSLNLEEILNATAAEVRQVLQTDRV
VIFQFEPDWSGNVVVESVASSCFSILGRNIYDPCFKQSYIVPYQQGRVKAIEDIYNANID
PCHINLLTQLQVRANLVVPILQSEQTLQNQTFPYPEGDRGEPSSQNRLWGLLIAHHCTEP
RTWGQWEMDLLTSLASQVAIAIQQSQLYEQAQYQRQREQALNQLTQAVRRSLDLQTIFST
ATCEIEKLLEVDCAQIVQYLPEQKLWVSVAESCKGVCTSACQSLEISDQNNPIADRLKRL
EVVRIDDTHLWQDEVYNACIQGLPGSWLLVPLHFGDSMWGALALVMNTESYHWQDSQVEL
ICKVADQLAIALQQAELYKQSCTAMAQAQSQAQQLEQTLIELRKTQAQLVQSEKMSSLGQ
LVAGVAHEINNPVSFIYGNLMHATDYTQDILGLVQLYQQYYPHPMPEIEGEIAAIDLDFL
LEDLPKLLSSMKVGAERICEIVAALRNFSRFAEAEMKPVDLHDGVDSTLMILQNRLKASG
GHPEIKVIKEYGNLPLVECYAGQLNQVFMNLLSNAIDAIDEQNQTLTPEQINANPSYIRV
CTELCNDNEVAIHIADNGPGISEEVKARLFDPFFTTKPVGTGTGLGLSISYQIVVEKHGG
KLHFYSQLGQGTEFVIQIPIQQTLKKP
Download sequence
Identical sequences K9WCT7
gi|428310639|ref|YP_007121616.1| WP_015182359.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]