SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310651|ref|YP_007121628.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310651|ref|YP_007121628.1|
Domain Number 1 Region: 883-1057
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.88e-42
Family Histidine kinase 0.00056
Further Details:      
 
Domain Number 2 Region: 1139-1209,1237-1283
Classification Level Classification E-value
Superfamily CheY-like 1.22e-34
Family CheY-related 0.0075
Further Details:      
 
Domain Number 3 Region: 629-802
Classification Level Classification E-value
Superfamily GAF domain-like 2.62e-29
Family GAF domain 0.0018
Further Details:      
 
Domain Number 4 Region: 1329-1446
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 3.27e-27
Family Aerobic respiration control sensor protein, ArcB 0.077
Further Details:      
 
Domain Number 5 Region: 814-895
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 2.35e-22
Family Homodimeric domain of signal transducing histidine kinase 0.0019
Further Details:      
 
Domain Number 6 Region: 172-292
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.35e-21
Family Heme-binding PAS domain 0.034
Further Details:      
 
Domain Number 7 Region: 62-177
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.34e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.046
Further Details:      
 
Domain Number 8 Region: 290-381
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000685
Family Heme-binding PAS domain 0.026
Further Details:      
 
Domain Number 9 Region: 442-477,520-631
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000000458
Family GAF domain 0.029
Further Details:      
 
Weak hits

Sequence:  gi|428310651|ref|YP_007121628.1|
Domain Number - Region: 409-435
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0785
Family Heme-binding PAS domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428310651|ref|YP_007121628.1|
Sequence length 1449
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MWDIIFQIISAATIGLLVGYFWGRGKKASSPESDPVCPNNLRECQQAEESLRESQRTLTT
LMSNLPGVVYRCQNDCNWTMEFVSEGCYPLTGYHPADLMENRTVSYGQLIHQDDRNWVWN
EIQCALQESRPFQLTYRIITATGEEKWVWEQGCGVFSPQGEVLAIEGFVTDITQRKQFEK
SLQESEERFRRLSEATYEGILIHEQGVIIDANQAIAKMFGYETDELIGVSGFHLLAPESR
DIALKQIQAAYVEPYEVVALSKEGSKFPIEIQAKLIPYQNRFVRVVAIRDISRRQQIEKE
LRQARDQLRAVLDAVPGSISWISSELNYLGVNRYLAKSFNQPPEFFVGKPIGFLQPGSQV
SEFLRQFFASSESEASLELDWQVDGVPSHYLIVAQKYLQGQAAVCAGFDITRRKQAEQEL
RYSEACIRALYEVTAAQDLTFNQRLQRLLELGCGWFGLDIGLLGRLEENCYQAIAFGGAQ
GAIAAFAAVQSDHLEPNVLVYDFVQESQGRTDFPTTANPALSTPILPKGSIFDWKLRNCQ
KIWQAAELVNLESAVAAQLSGYPAQSIAAMEAYLRTPVTVAGQVYGTLGFWSCRKRNRNF
KAVERELLKLMARWIGGEIERQQAADALQQQFHRALLLKQITQEIRQSLDTQQILQTTAM
QVGRALRVNRCLLFRYEATPPSRLVCVAEYLGGRHTSLLDLLELAVKGNPYLEEILSQDR
AIPVTHIDGYQLLQPFVRLFHRLGVQSLLTVRTSYHGQPNGVINVHQCDAIRGWSEDEIE
LLEAVADQVGIALAQAHLLEQEKQQREQLAEQNVALEQAKQAAEVANQAKSEFLAMMSHE
IRTPMNGIIGMNNLLLNTSLTEQQQEFARTIGSSSEALLRIINDILDLSKIESGKLEWED
QPFDLLSCIEAAVNLLTPKAVDQRLELTYQMDAQTPLTLVGDVTRLHQILLNLLSNAVKF
TDAGQVKVSVTAHALGNSEPSNLVLNPHSPFPRLYEIQFAVQDTGIGISPEQMNRLFKPF
SQVDASTSRRYGGTGLGLAISQRLCELMGGRMWVESHGVCAGNPPEDLVWENRNRPGDEP
ILDTVEFDPLSHPPTSSGSTFYFTIVAPGYPFTQPVRDQGDRLLLERTLPITQPFPSIPL
RILLAEDNRVNQQVALLTLKQLGYQADVVNNGREVLEALRRQPYDVVLMDVEMPQMDGLT
ATRLICQEWNADLILKNAGKESPITQSDAVTTYLQSQRPRIIAMTAYAMAGDRQKCLEAG
MDDYISKPIQEQELIRALQLCQSAIGESRKPPTQEGGGAGELGSWGAGEPGSRGKSLLSL
TATGYDNVDSPPVLDHRVLNSLRQMTGSKAATLLRQIIDDYREDAPQQLQDIRDAVAAGD
AQALRQSAHTLRSSSANLGAMNLSYLCKELEMIGRAGTTTDAPEWIAQVEAEYEKVKVAL
QLEYKQFSS
Download sequence
Identical sequences K9WFC4
gi|428310651|ref|YP_007121628.1| WP_015182371.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]