SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310678|ref|YP_007121655.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310678|ref|YP_007121655.1|
Domain Number 1 Region: 22-356
Classification Level Classification E-value
Superfamily Pectin lyase-like 6.59e-34
Family Filamentous hemagglutinin FhaB, secretion domain 0.0062
Further Details:      
 
Domain Number 2 Region: 592-689
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000000408
Family P22 tailspike protein 0.087
Further Details:      
 
Domain Number 3 Region: 758-884
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000000000251
Family P22 tailspike protein 0.065
Further Details:      
 
Domain Number 4 Region: 409-596
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000173
Family Filamentous hemagglutinin FhaB, secretion domain 0.039
Further Details:      
 
Domain Number 5 Region: 885-1001
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000408
Family Filamentous hemagglutinin FhaB, secretion domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428310678|ref|YP_007121655.1|
Sequence length 1353
Comment filamentous hemagglutinin family domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MIRPVFRFWRAGYLLLGCLATASSVQAQIVPDDTLPVNSWVTPGCTVCTIDGGTHRGVNL
FHSFSEFSVPTGGEAFFNNALQIQNIFSRVTGNSVSNIDGLLRANGTASLFFLNPNGVIF
GQNARLEIGGSFFATTGNSFKFSDGSEFSAIKPQAPPLLTINVTPGVQWGTNQPGATITN
RGNLAVGQDLTLAAGNLDLQGQLVAGRNLTLQATDTVKVRDSSTSPFIASSGGTLLVQGN
QKVDIFALNHPDSGLFSGGNMVLRSANTLGGDAHYWSGGSFRIEKLDGSLGDLYSPNDPI
IRSLGDVSFDIYQGTSLHILAGGEVNIGTVIITGAETGAAGVDYLQETVPLSNGSEVSIN
GRLQPTLDIRAGVDPAFIGVPGITGFNFPRDRLLGWALGTNTPTSANITIGDVWIVPPNG
LVFITNQYQPNTTLPGGDITITGAGVFGDGIDASSRRGNGGSVILDSRRNIGITNSGIDS
FSEAGNAGSILLNAKDTISLTSSFVTSATSGGGKGGDVTINAGQLLLKDGSQILVGTLGA
GIGGNLIVNSRGSIVLTNSIIDSSSEAGNAGSIFLNAKDTISLTSSFVASQTFGAGKGGD
VTIKTGQLLVRDGSQILVDTFGVGTGGNLVVNASESVQLNGVLPINPLAGSSLSASTEGT
GKAGNITITTPSLHIQDGGRIIVSTEGAGDAGSLTVNASESVEIIDLSPEGLIVSALFAQ
ANRGATGNAGDLTINTKHLLVRDGAQVAVSNLGTEGAGGILTVNASESVEVIGIGISANG
GEVTSGLFARTEGAGDAKDLTINTRQLIVQDGAEISASTKGAGDGGDLIVNASESIQLIG
ESSGFFTQVNRGATGNAGDLTINTKHLLVRDGAQVSSGNLGEGNGGNLIVNAFESVKLIG
TSPDGLVPSGLFAVTKAVGDAGDLMITTPTLLVQQGAWMSAFTSGVGSAGSILVKDANLV
LLSNNSGISTESVSAGLAGDVTLDTQQLILEQGSQLTAATVSSQGGSIILQNLETLEILN
SSISASTETGTAGNIVIGSSESVQLYGVSRLSVEATEGGTAGDIIVKTNEMSVTGGAQVT
VSSPQGQAGNLSITANSLTLNRGTLSAVTGTSSPGGGANITLSGLDFLRMDNESLISASA
LNNANGGNVTIDSTLIVATPPIGPEGSDIIANAEQGNGGRVNITTQGLFGIQFRPQRTPK
NDITVSSTFGLSGTFALNTPGVDPSRGLAQLPTNLVDASQQIDQRCTPKAANQGGSFTVT
GRGGIPPSPNDTLQAESLITPNWVILDFETENNTPPAPTTPSNSAPKQLVEAQGWRINEQ
GQVVLTASAPNVTPHHTWQTPVECPAEANPVPE
Download sequence
Identical sequences K9WER0
WP_015182398.1.75295 gi|428310678|ref|YP_007121655.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]