SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310684|ref|YP_007121661.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310684|ref|YP_007121661.1|
Domain Number 1 Region: 1011-1173
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.57e-35
Family Histidine kinase 0.00057
Further Details:      
 
Domain Number 2 Region: 795-921
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.28e-27
Family Flavin-binding PAS domain 0.059
Further Details:      
 
Domain Number 3 Region: 115-238
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.91e-27
Family Flavin-binding PAS domain 0.075
Further Details:      
 
Domain Number 4 Region: 409-559
Classification Level Classification E-value
Superfamily GAF domain-like 2.84e-22
Family GAF domain 0.019
Further Details:      
 
Domain Number 5 Region: 668-776
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.26e-21
Family Heme-binding PAS domain 0.07
Further Details:      
 
Domain Number 6 Region: 547-670
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.49e-19
Family Heme-binding PAS domain 0.059
Further Details:      
 
Domain Number 7 Region: 938-1021
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 6.47e-18
Family Homodimeric domain of signal transducing histidine kinase 0.0035
Further Details:      
 
Weak hits

Sequence:  gi|428310684|ref|YP_007121661.1|
Domain Number - Region: 236-294
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00309
Family Heme-binding PAS domain 0.064
Further Details:      
 
Domain Number - Region: 329-387
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00628
Family Heme-binding PAS domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428310684|ref|YP_007121661.1|
Sequence length 1178
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]
Sequence
MVRATQSQMQPYGVAVLAVGLAMLLMRLLNSWVTMSHSPFLMFFGAVMVSAWYGGMGAGL
FATFLSALLSTYFIDSPSHGLAFSLSNSLRLSVFVLEGILISGLCETLLTTNRQLQVSVR
KLRESEERYRRVLDTAYEGIWTVDAQGQINYVNQRIAEILGYTMQNMLARPMFDFMDEEA
QSEANHYLERQQQGIKEQYDFRFRHQDGSSVWAIVSTSPICSETGEFQGAIAMITDVSER
KRAEESLREQAATLQNQQSWLESVLNFLPSPLLLIEPGTARVTFANQAADQMAGGEFPKN
KPSEEYHTVYYCTDAKGERIPDDQMPGVRVARGEQLKGFEMDWHTPEGIRSLIIFADTLS
PMYGHPPTCVLVFQDISERKRVEQALELRLQQQAIVAQLSQRALSGIELSTLIDEVPILV
AQSLDVEYCKVLELLPDGKALLLRSGVGWHPGLVGHATVGSETHSQAGYTLLSSQPVIVE
DLRKETRFNGPPLLHEHQVISGMSVIIHGQNRPFGVFGVHTTRKQKFSQNDINFLQAVAN
VLAIAIERKRAEEAMRESQELFERFMSHAPVVAFIKDEQGRFLYVNSLLERTWNRPLADW
LGKTDFDLFPAEQAQQWRDNDTAVLAGDKAVQLLETSVNQDRVQSWLSFKFPFIDASGRR
FLAGMSLDISDRKRLEDELRQSEAKFRRLFDANIVGIIFSDFSGKILEANDAFLEMVGYT
REDLHAGRVCWDTMTPSEYKPLDELAIAELRTSGVCTAFEKEYIRQDGSRVPVLLIGALL
EGEPEQAVSFILDLSDRKQALAELRESESRFRNMADTAPVLIWMSGTDKLCNYFNQPWLD
FTGRTMEQEFGNGWAEGVHPDDYQRCLNTYMNAFDARQSFRMDYRLRRFDGEYRWVLDTG
IPRFTPDGGFLGYIGSCIDISDRVLAEEEVVKLNHSLEQRVKERTAQLEAANQELESFSY
SVSHDLRAPLRHINGFVDLLQKQAATTLDERSLRYLSIITETTKQAGKLVDDLLSFSRMG
RTEMRYIKVNMTLLIQEVKRDIEQDICGRNITWQIEDLPQVYGDPSMLRLVVHNLIDNAV
KYTAKRDRAEIKIGSTETEDEFVFFVRDNGVGFDMRYVHKLFGVFQRLHSFQEFEGTGIG
LANVKRIIDRHKGRTWAESVVKKGASFYFSLPKLNNKI
Download sequence
Identical sequences K9WCX2
WP_015182404.1.75295 gi|428310684|ref|YP_007121661.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]