SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310752|ref|YP_007121729.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310752|ref|YP_007121729.1|
Domain Number 1 Region: 723-904
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.57e-35
Family Histidine kinase 0.0048
Further Details:      
 
Domain Number 2 Region: 633-674,704-735
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000049
Family Homodimeric domain of signal transducing histidine kinase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428310752|ref|YP_007121729.1|
Sequence length 909
Comment histidine kinase [Microcoleus sp. PCC 7113]
Sequence
MVLHQNRLIKKLRGKKFRNVVTSSKKLAVSQAHWRLRSSFVLAVLILAGYAGNYFNLSLF
FGVDFLFGSIAVLMVVWLYGIGWGAVAAMLAGSHTFLLWGHPYAGIILIGEALFVGWWRR
KCPNLLLLDGFYWIFVGMPLVWLFYSIPLGVPSQTVFLVMFKQGINGIFNALIASLLLTH
SPIPTWADRPKIAKTLSLQQTLFNLLVAFVLFPALTLLVLNSRSAISNMEKTIQANLETV
STDLAIEVRFWHQQNLNALKQLAEVAVHSDIKSSIKLQESTELLQRTFSTIDQLFVMNRE
GQTLSFAGIGSTIASYSELEKTITESIGMKASDLTQPSITSQVLLIDDHHAPPRLVQIVP
IIRNYRLVGSVVSEIDLSHLAQLLKSFTTLREMEITLLDRQDRVITSTRLDMPTLSKFKQ
RQGGEIRPLNDKVYQWLPLGEMPIMMRWKKSFYVQKTSAGEKLPFQVIVAVPTQPHFIYL
ENLYIKSLSILLLITALALAMANVISRWLAQPLLQLAELTTDLPDKLLNQKAIHWPNSWI
TEMNTLVSNSQFMAELLEQKFHEINAAKEQLEQRVQERTRELSTANQELELEVSKRQRVA
EALQESEALLRTQAKDLETALYELQHTQAQLIQTEKMSSLGQLVAGVAHEINNPINFIYG
NLIHAQDYTQDLLRLVELYQQHCPNFLSIMQEEIEAIDLDFLKDDLPKLMDSMQVGAERI
HEIVQSLRSFSRLDEAEVKAVDIHEGIDSTLMILKSRLKATLKHPGIEVIKEYGQLPLVE
CYPGQLNQVFMNILVNSIDSLEDKFTYNAEENRPSLDSLPWIRIYTEIVKEDWVAIRISD
NGMGIKKDQSCKLFDPFFTTKPIGKGTGLGLSISYQIIVEKHGGKLYCVAEPKQGAEFMI
EIPLRQTRG
Download sequence
Identical sequences K9WDL1
gi|428310752|ref|YP_007121729.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]