SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|428310818|ref|YP_007121795.1| from Microcoleus sp. PCC 7113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428310818|ref|YP_007121795.1|
Domain Number 1 Region: 416-587
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.29e-50
Family Histidine kinase 0.0015
Further Details:      
 
Domain Number 2 Region: 609-730
Classification Level Classification E-value
Superfamily CheY-like 7.68e-34
Family CheY-related 0.019
Further Details:      
 
Domain Number 3 Region: 36-176
Classification Level Classification E-value
Superfamily GAF domain-like 4.71e-25
Family GAF domain 0.041
Further Details:      
 
Domain Number 4 Region: 348-427
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 3.14e-18
Family Homodimeric domain of signal transducing histidine kinase 0.0013
Further Details:      
 
Domain Number 5 Region: 197-342
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000000000698
Family GAF domain 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428310818|ref|YP_007121795.1|
Sequence length 730
Comment signal transduction histidine kinase [Microcoleus sp. PCC 7113]
Sequence
MTNLMAEAMPMAPIPANEVERLAALYRYRILDTPPEAAFDRLTTLAARLFDMPIALVSLV
DKSRAWFKSCHGFNLSEVPRDATICSFALLYNQVLVVPDTRQDERFACNPFVQSEPGVRF
YAGAPLVTHDGFNLGTLCLLDSKPRDALSAEQQTILADLAAMVVDELELRYSANRITQID
QALLAVTQGVSAATGEAFFYSLVQHFANVLAVDYTYIGLLVERDSEELIQTIATCAQGQI
VDNFEYLLRDTPCQAVLKHRKICCYPSSVQALFPHAPLLAPLQIESYIAVPFFDSTGTPL
GLLGVMDRKPLENAQLTETLLSIFSMRIAAELERQWAEEKRIQMLAREQEAREQAEAANR
IKDEFLAVLSHELRSPLNPILGWSKLLRSGKLNAAKTAQALEIIERNAKLQSQLIEDLLD
VSRILRGKLSLNMVPVNLASTIKAALETVRLAAEAKSIQIQTMFDPTIGQVLGDAARLQQ
VIWNLLTNAVKFTPEGGRVEIQLQLIGSQAQIQVRDTGKGISPDFLPHVFEYFRQADATT
TRTFGGLGLGLAIVRHLVELHGGTVQVDSPGEGQGATFTVRLPLIKDKSSKQKAEGNSSP
LTPEPSPLTGIRVLVVDDDTDSREFIAFALEQLGAQVSTVTSAEEAIAFLEQSQPNILLS
DIGMPDMDGYMLMRQIRAMPPEQGGQILAIALTAYAGEIDRQQALFAGFQHHLAKPVEPN
ELVKMILSLL
Download sequence
Identical sequences K9WF39
gi|428310818|ref|YP_007121795.1| WP_015182538.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]